Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPOK113_RS06695 Genome accession   NC_020508
Coordinates   1376710..1376835 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori OK113     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1371710..1381835
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPOK113_RS06675 (HPOK113_1299) - 1372394..1373806 (-) 1413 WP_015428292.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPOK113_RS06680 (HPOK113_1300) comB10 1373876..1375012 (-) 1137 WP_015428293.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPOK113_RS06685 (HPOK113_1301) comB9 1375005..1375970 (-) 966 WP_015428294.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPOK113_RS06690 (HPOK113_1302) comB8 1375970..1376713 (-) 744 WP_000660529.1 type IV secretion system protein Machinery gene
  HPOK113_RS06695 comB7 1376710..1376835 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPOK113_RS06700 (HPOK113_1303) comB6 1376851..1377906 (-) 1056 WP_015428295.1 P-type conjugative transfer protein TrbL Machinery gene
  HPOK113_RS06705 (HPOK113_1304) - 1377912..1378907 (-) 996 WP_015428296.1 PDZ domain-containing protein -
  HPOK113_RS06710 (HPOK113_1305) - 1378907..1379200 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  HPOK113_RS06715 (HPOK113_1306) panD 1379211..1379561 (-) 351 WP_015428297.1 aspartate 1-decarboxylase -
  HPOK113_RS06720 (HPOK113_1307) - 1379551..1381773 (-) 2223 WP_015428298.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=46341 HPOK113_RS06695 WP_001217874.1 1376710..1376835(-) (comB7) [Helicobacter pylori OK113]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=46341 HPOK113_RS06695 WP_001217874.1 1376710..1376835(-) (comB7) [Helicobacter pylori OK113]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment