Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HWU19_RS00200 Genome accession   NZ_CP058251
Coordinates   37115..37228 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain UBN18     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32115..42228
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWU19_RS00175 - 32177..34402 (+) 2226 WP_237016559.1 AAA family ATPase -
  HWU19_RS00180 panD 34392..34745 (+) 354 WP_000142243.1 aspartate 1-decarboxylase -
  HWU19_RS00185 - 34748..35041 (+) 294 WP_237016560.1 YbaB/EbfC family nucleoid-associated protein -
  HWU19_RS00190 - 35041..36036 (+) 996 WP_237017033.1 PDZ domain-containing protein -
  HWU19_RS00195 comB6 36044..37099 (+) 1056 WP_237017034.1 P-type conjugative transfer protein TrbL Machinery gene
  HWU19_RS00200 comB7 37115..37228 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HWU19_RS00205 comB8 37225..37962 (+) 738 WP_237016561.1 type IV secretion system protein Machinery gene
  HWU19_RS00210 comB9 37962..38930 (+) 969 WP_237016562.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWU19_RS00215 comB10 38923..40053 (+) 1131 WP_237016563.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWU19_RS00220 - 40123..41535 (+) 1413 WP_237016564.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=463043 HWU19_RS00200 WP_001217873.1 37115..37228(+) (comB7) [Helicobacter pylori strain UBN18]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=463043 HWU19_RS00200 WP_001217873.1 37115..37228(+) (comB7) [Helicobacter pylori strain UBN18]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1