Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HUW87_RS08780 Genome accession   NZ_CP058237
Coordinates   1800417..1800908 (-) Length   163 a.a.
NCBI ID   WP_145461252.1    Uniprot ID   -
Organism   Weissella cibaria strain JW15     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1770391..1808575 1800417..1800908 within 0


Gene organization within MGE regions


Location: 1770391..1808575
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUW87_RS08585 (HUW87_08535) - 1770391..1771410 (-) 1020 WP_242874186.1 GH25 family lysozyme -
  HUW87_RS08590 (HUW87_08540) - 1771412..1771732 (-) 321 WP_242874187.1 phage holin, LLH family -
  HUW87_RS08595 (HUW87_08545) - 1771719..1771949 (-) 231 WP_060654748.1 hypothetical protein -
  HUW87_RS08600 (HUW87_08550) - 1771962..1772210 (-) 249 WP_060654746.1 hypothetical protein -
  HUW87_RS08605 (HUW87_08555) - 1772203..1772370 (-) 168 WP_242874188.1 hypothetical protein -
  HUW87_RS08610 (HUW87_08560) - 1772386..1777587 (-) 5202 WP_242874189.1 phage tail protein -
  HUW87_RS08615 (HUW87_08565) - 1777597..1778493 (-) 897 WP_242874190.1 phage tail protein -
  HUW87_RS08620 (HUW87_08570) - 1778503..1781637 (-) 3135 WP_242874191.1 phage tail tape measure protein -
  HUW87_RS08625 (HUW87_08575) - 1781654..1781860 (-) 207 WP_118123272.1 hypothetical protein -
  HUW87_RS08630 (HUW87_08580) - 1781953..1782393 (-) 441 WP_242874192.1 tail assembly chaperone -
  HUW87_RS08635 (HUW87_08585) - 1782479..1783093 (-) 615 WP_118123274.1 phage major tail protein, TP901-1 family -
  HUW87_RS08640 (HUW87_08590) - 1783102..1783470 (-) 369 WP_128735697.1 hypothetical protein -
  HUW87_RS08645 (HUW87_08595) - 1783467..1783829 (-) 363 WP_242874193.1 HK97-gp10 family putative phage morphogenesis protein -
  HUW87_RS08650 (HUW87_08600) - 1783832..1784116 (-) 285 WP_242874194.1 hypothetical protein -
  HUW87_RS08655 (HUW87_08605) - 1784116..1784457 (-) 342 WP_128735694.1 phage head-tail connector protein -
  HUW87_RS08660 - 1784468..1784581 (-) 114 Protein_1657 HeH/LEM domain-containing protein -
  HUW87_RS08665 (HUW87_08615) - 1784767..1785666 (-) 900 WP_145461244.1 phage capsid protein -
  HUW87_RS08670 (HUW87_08620) - 1785692..1786261 (-) 570 WP_242874195.1 DUF4355 domain-containing protein -
  HUW87_RS08675 (HUW87_08625) - 1786395..1786646 (-) 252 WP_195318005.1 hypothetical protein -
  HUW87_RS08680 (HUW87_08630) - 1786653..1788368 (-) 1716 WP_242874196.1 minor capsid protein -
  HUW87_RS08685 (HUW87_08635) - 1788355..1789902 (-) 1548 WP_242874197.1 phage portal protein -
  HUW87_RS08690 (HUW87_08640) - 1789911..1791191 (-) 1281 WP_242874198.1 PBSX family phage terminase large subunit -
  HUW87_RS08695 (HUW87_08645) - 1791184..1791606 (-) 423 WP_242874199.1 terminase small subunit -
  HUW87_RS08710 (HUW87_08660) - 1792166..1792594 (-) 429 WP_341352994.1 HNH endonuclease -
  HUW87_RS08715 (HUW87_08665) - 1792668..1792832 (-) 165 WP_160280047.1 hypothetical protein -
  HUW87_RS08720 (HUW87_08670) - 1793329..1793790 (-) 462 WP_242874201.1 DUF722 domain-containing protein -
  HUW87_RS08725 (HUW87_08675) - 1793917..1794489 (-) 573 WP_242874202.1 RloB family protein -
  HUW87_RS08730 (HUW87_08680) - 1794494..1795774 (-) 1281 WP_242874203.1 ATP-binding protein -
  HUW87_RS08735 (HUW87_08685) - 1796322..1796735 (-) 414 WP_145559015.1 ArpU family phage packaging/lysis transcriptional regulator -
  HUW87_RS08740 (HUW87_08690) - 1796819..1797007 (-) 189 WP_242874204.1 hypothetical protein -
  HUW87_RS08745 (HUW87_08695) - 1797011..1797337 (-) 327 WP_242874205.1 hypothetical protein -
  HUW87_RS08750 (HUW87_08700) - 1797334..1797894 (-) 561 WP_242874206.1 hypothetical protein -
  HUW87_RS08755 (HUW87_08705) - 1797894..1798277 (-) 384 WP_242874207.1 hypothetical protein -
  HUW87_RS08760 (HUW87_08710) - 1798277..1798423 (-) 147 WP_167849173.1 hypothetical protein -
  HUW87_RS08765 (HUW87_08715) - 1798486..1798854 (-) 369 WP_242874208.1 hypothetical protein -
  HUW87_RS08770 (HUW87_08720) - 1798857..1799582 (-) 726 WP_242874209.1 ATP-binding protein -
  HUW87_RS08775 (HUW87_08725) - 1799582..1800406 (-) 825 WP_145529164.1 phage replisome organizer N-terminal domain-containing protein -
  HUW87_RS08780 (HUW87_08730) ssb 1800417..1800908 (-) 492 WP_145461252.1 single-stranded DNA-binding protein Machinery gene
  HUW87_RS08785 (HUW87_08735) - 1800874..1801584 (-) 711 WP_164238813.1 putative HNHc nuclease -
  HUW87_RS08790 (HUW87_08740) - 1801584..1802225 (-) 642 WP_043941011.1 ERF family protein -
  HUW87_RS08795 (HUW87_08745) - 1802227..1802409 (-) 183 WP_118123299.1 hypothetical protein -
  HUW87_RS08800 (HUW87_08750) - 1802402..1802545 (-) 144 WP_182279142.1 hypothetical protein -
  HUW87_RS08805 (HUW87_08755) - 1802625..1803152 (-) 528 WP_242874210.1 hypothetical protein -
  HUW87_RS08810 (HUW87_08760) - 1803153..1803338 (-) 186 WP_118123301.1 hypothetical protein -
  HUW87_RS08815 (HUW87_08765) - 1803335..1803532 (-) 198 WP_063083174.1 hypothetical protein -
  HUW87_RS08820 (HUW87_08770) - 1803535..1803768 (-) 234 WP_118123302.1 hypothetical protein -
  HUW87_RS08825 - 1803771..1804178 (-) 408 WP_242874211.1 ORF6C domain-containing protein -
  HUW87_RS08830 (HUW87_08775) - 1804200..1804496 (-) 297 WP_242874212.1 Rha family transcriptional regulator -
  HUW87_RS08835 (HUW87_08780) - 1804496..1804696 (-) 201 WP_118123304.1 XRE family transcriptional regulator -
  HUW87_RS08840 (HUW87_08785) - 1804961..1805308 (+) 348 WP_118123305.1 helix-turn-helix domain-containing protein -
  HUW87_RS08845 (HUW87_08790) - 1805309..1805719 (+) 411 WP_118123306.1 ImmA/IrrE family metallo-endopeptidase -
  HUW87_RS08850 (HUW87_08795) bamE 1805788..1806405 (+) 618 WP_242874213.1 outer membrane protein assembly factor BamE -
  HUW87_RS08855 (HUW87_08800) - 1806576..1807667 (+) 1092 WP_242874214.1 tyrosine-type recombinase/integrase -
  HUW87_RS08860 (HUW87_08805) - 1807841..1808575 (-) 735 WP_063083185.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -

Sequence


Protein


Download         Length: 163 a.a.        Molecular weight: 18013.72 Da        Isoelectric Point: 4.9371

>NTDB_id=462889 HUW87_RS08780 WP_145461252.1 1800417..1800908(-) (ssb) [Weissella cibaria strain JW15]
MNHVSLIGRLTKEPELRYTTSGAAVASGTIAVNRDFTNANGERESDFINFVIWRKAAENFVNMTAKGSQVGLEGSWQTRS
YENQQGQRVYVSELVVSNFTLVETKEQTEQRKGQSAQQGNGGFKSTPSQNNFNGQQAPQQGGFSPNDMYGKDLPPLNDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=462889 HUW87_RS08780 WP_145461252.1 1800417..1800908(-) (ssb) [Weissella cibaria strain JW15]
ATGAATCACGTCTCGCTAATCGGTCGGCTCACTAAGGAACCAGAACTTAGGTACACCACGTCAGGTGCAGCAGTTGCATC
AGGAACAATCGCAGTTAACCGAGATTTTACGAACGCTAATGGGGAGCGTGAGAGTGACTTCATCAACTTTGTAATTTGGC
GCAAGGCTGCCGAAAACTTTGTCAATATGACCGCTAAGGGGTCACAGGTTGGTTTGGAAGGTTCTTGGCAAACACGAAGC
TATGAGAACCAACAAGGACAGCGTGTATACGTTTCTGAACTAGTAGTAAGTAACTTTACTTTAGTTGAAACAAAAGAGCA
GACAGAGCAACGCAAGGGGCAATCAGCACAACAAGGTAATGGTGGGTTCAAGAGTACACCATCACAAAACAACTTCAATG
GTCAGCAAGCACCACAGCAAGGTGGTTTCTCGCCTAATGATATGTACGGTAAAGACTTACCGCCGTTGAACGATGATGAC
CTTCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

54.386

100

0.571

  ssbA Bacillus subtilis subsp. subtilis str. 168

47.674

100

0.503

  ssb Vibrio cholerae strain A1552

35.593

100

0.387