Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSU6051_RS12785 | Genome accession | NC_020507 |
| Coordinates | 2552429..2552602 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis 6051-HGW | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547429..2557602
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU6051_RS12770 (BSU6051_24570) | gcvT | 2548228..2549316 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSU6051_RS12775 (BSU6051_24580) | hepAA | 2549758..2551431 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| BSU6051_RS12780 (BSU6051_24590) | yqhG | 2551452..2552246 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| BSU6051_RS12785 (BSU6051_24600) | sinI | 2552429..2552602 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| BSU6051_RS12790 (BSU6051_24610) | sinR | 2552636..2552971 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSU6051_RS12795 (BSU6051_24620) | tasA | 2553064..2553849 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| BSU6051_RS12800 (BSU6051_24630) | sipW | 2553913..2554485 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| BSU6051_RS12805 (BSU6051_24640) | tapA | 2554469..2555230 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSU6051_RS12810 (BSU6051_24650) | yqzG | 2555502..2555828 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BSU6051_RS12815 (BSU6051_24660) | spoIITA | 2555870..2556049 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| BSU6051_RS12820 (BSU6051_24670) | comGG | 2556120..2556494 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| BSU6051_RS12825 (BSU6051_24680) | comGF | 2556495..2556878 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| BSU6051_RS12830 (BSU6051_24690) | comGE | 2556904..2557251 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=46241 BSU6051_RS12785 WP_003230187.1 2552429..2552602(+) (sinI) [Bacillus subtilis subsp. subtilis 6051-HGW]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=46241 BSU6051_RS12785 WP_003230187.1 2552429..2552602(+) (sinI) [Bacillus subtilis subsp. subtilis 6051-HGW]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |