Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C663_RS15385 Genome accession   NC_020244
Coordinates   3068945..3069085 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis XF-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3063945..3074085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C663_RS15360 (C663_3028) yuxO 3064288..3064668 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  C663_RS15365 comA 3064686..3065330 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C663_RS15370 (C663_3030) comP 3065411..3067711 (-) 2301 WP_041518027.1 histidine kinase Regulator
  C663_RS15375 (C663_3031) comX 3067723..3067887 (-) 165 WP_015384519.1 competence pheromone ComX -
  C663_RS15380 (C663_3032) comQ 3067900..3068760 (-) 861 WP_015483633.1 polyprenyl synthetase family protein Regulator
  C663_RS15385 (C663_3033) degQ 3068945..3069085 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C663_RS21800 - 3069307..3069369 (+) 63 Protein_3096 hypothetical protein -
  C663_RS15390 (C663_3034) - 3069547..3069915 (+) 369 WP_015483634.1 hypothetical protein -
  C663_RS15395 (C663_3035) pdeH 3069891..3071120 (-) 1230 WP_015384522.1 cyclic di-GMP phosphodiesterase -
  C663_RS15400 (C663_3036) pncB 3071257..3072729 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C663_RS15405 (C663_3037) pncA 3072745..3073296 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  C663_RS15410 (C663_3038) yueI 3073393..3073791 (-) 399 WP_015483635.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=45822 C663_RS15385 WP_003220708.1 3068945..3069085(-) (degQ) [Bacillus subtilis XF-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=45822 C663_RS15385 WP_003220708.1 3068945..3069085(-) (degQ) [Bacillus subtilis XF-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment