Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HUW56_RS05100 Genome accession   NZ_CP055160
Coordinates   1182252..1182629 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain WLYS23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1177252..1187629
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUW56_RS05060 (HUW56_05060) - 1177749..1178543 (+) 795 WP_007612541.1 YqhG family protein -
  HUW56_RS05065 (HUW56_05065) sinI 1178720..1178893 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  HUW56_RS05070 (HUW56_05070) sinR 1178927..1179262 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUW56_RS05075 (HUW56_05075) tasA 1179310..1180095 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  HUW56_RS05080 (HUW56_05080) sipW 1180160..1180744 (-) 585 WP_032874025.1 signal peptidase I SipW -
  HUW56_RS05085 (HUW56_05085) tapA 1180716..1181387 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HUW56_RS05090 (HUW56_05090) - 1181646..1181975 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HUW56_RS05095 (HUW56_05095) - 1182016..1182195 (-) 180 WP_022552966.1 YqzE family protein -
  HUW56_RS05100 (HUW56_05100) comGG 1182252..1182629 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUW56_RS05105 (HUW56_05105) comGF 1182630..1183130 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HUW56_RS05110 (HUW56_05110) comGE 1183039..1183353 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HUW56_RS05115 (HUW56_05115) comGD 1183337..1183774 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HUW56_RS05120 (HUW56_05120) comGC 1183764..1184030 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HUW56_RS05125 (HUW56_05125) comGB 1184077..1185114 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HUW56_RS05130 (HUW56_05130) comGA 1185101..1186171 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HUW56_RS05135 (HUW56_05135) - 1186368..1187318 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=456491 HUW56_RS05100 WP_032874019.1 1182252..1182629(-) (comGG) [Bacillus velezensis strain WLYS23]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=456491 HUW56_RS05100 WP_032874019.1 1182252..1182629(-) (comGG) [Bacillus velezensis strain WLYS23]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488