Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HUW56_RS05110 Genome accession   NZ_CP055160
Coordinates   1183039..1183353 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain WLYS23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1178039..1188353
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUW56_RS05065 (HUW56_05065) sinI 1178720..1178893 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  HUW56_RS05070 (HUW56_05070) sinR 1178927..1179262 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUW56_RS05075 (HUW56_05075) tasA 1179310..1180095 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  HUW56_RS05080 (HUW56_05080) sipW 1180160..1180744 (-) 585 WP_032874025.1 signal peptidase I SipW -
  HUW56_RS05085 (HUW56_05085) tapA 1180716..1181387 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HUW56_RS05090 (HUW56_05090) - 1181646..1181975 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HUW56_RS05095 (HUW56_05095) - 1182016..1182195 (-) 180 WP_022552966.1 YqzE family protein -
  HUW56_RS05100 (HUW56_05100) comGG 1182252..1182629 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUW56_RS05105 (HUW56_05105) comGF 1182630..1183130 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HUW56_RS05110 (HUW56_05110) comGE 1183039..1183353 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HUW56_RS05115 (HUW56_05115) comGD 1183337..1183774 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HUW56_RS05120 (HUW56_05120) comGC 1183764..1184030 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HUW56_RS05125 (HUW56_05125) comGB 1184077..1185114 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HUW56_RS05130 (HUW56_05130) comGA 1185101..1186171 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HUW56_RS05135 (HUW56_05135) - 1186368..1187318 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=456492 HUW56_RS05110 WP_032874016.1 1183039..1183353(-) (comGE) [Bacillus velezensis strain WLYS23]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=456492 HUW56_RS05110 WP_032874016.1 1183039..1183353(-) (comGE) [Bacillus velezensis strain WLYS23]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481