Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HUW56_RS05065 Genome accession   NZ_CP055160
Coordinates   1178720..1178893 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain WLYS23     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1173720..1183893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUW56_RS05050 (HUW56_05050) gcvT 1174534..1175634 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  HUW56_RS05055 (HUW56_05055) - 1176057..1177727 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  HUW56_RS05060 (HUW56_05060) - 1177749..1178543 (+) 795 WP_007612541.1 YqhG family protein -
  HUW56_RS05065 (HUW56_05065) sinI 1178720..1178893 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  HUW56_RS05070 (HUW56_05070) sinR 1178927..1179262 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUW56_RS05075 (HUW56_05075) tasA 1179310..1180095 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  HUW56_RS05080 (HUW56_05080) sipW 1180160..1180744 (-) 585 WP_032874025.1 signal peptidase I SipW -
  HUW56_RS05085 (HUW56_05085) tapA 1180716..1181387 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HUW56_RS05090 (HUW56_05090) - 1181646..1181975 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HUW56_RS05095 (HUW56_05095) - 1182016..1182195 (-) 180 WP_022552966.1 YqzE family protein -
  HUW56_RS05100 (HUW56_05100) comGG 1182252..1182629 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUW56_RS05105 (HUW56_05105) comGF 1182630..1183130 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  HUW56_RS05110 (HUW56_05110) comGE 1183039..1183353 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HUW56_RS05115 (HUW56_05115) comGD 1183337..1183774 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=456489 HUW56_RS05065 WP_032874029.1 1178720..1178893(+) (sinI) [Bacillus velezensis strain WLYS23]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=456489 HUW56_RS05065 WP_032874029.1 1178720..1178893(+) (sinI) [Bacillus velezensis strain WLYS23]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719