Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   I33_RS15180 Genome accession   NC_017195
Coordinates   3047891..3048031 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. RO-NN-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3042891..3053031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I33_RS15155 (I33_3259) yuxO 3043241..3043621 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  I33_RS15160 (I33_3260) comA 3043640..3044284 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  I33_RS15165 (I33_3261) comP 3044365..3046662 (-) 2298 WP_041519489.1 histidine kinase Regulator
  I33_RS15170 (I33_3262) comX 3046670..3046831 (-) 162 WP_003241045.1 competence pheromone ComX -
  I33_RS15175 (I33_3263) - 3046846..3047706 (-) 861 WP_014477833.1 polyprenyl synthetase family protein -
  I33_RS15180 (I33_3264) degQ 3047891..3048031 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  I33_RS21070 - 3048253..3048378 (+) 126 WP_154796978.1 hypothetical protein -
  I33_RS15185 (I33_3265) - 3048492..3048860 (+) 369 WP_014477834.1 hypothetical protein -
  I33_RS15190 (I33_3266) pdeH 3048836..3050065 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  I33_RS15195 (I33_3267) pncB 3050202..3051674 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  I33_RS15200 (I33_3268) pncA 3051690..3052241 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  I33_RS15205 (I33_3269) yueI 3052338..3052736 (-) 399 WP_014477837.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=45437 I33_RS15180 WP_003220708.1 3047891..3048031(-) (degQ) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=45437 I33_RS15180 WP_003220708.1 3047891..3048031(-) (degQ) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment