Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   I33_RS11900 Genome accession   NC_017195
Coordinates   2404805..2405179 (-) Length   124 a.a.
NCBI ID   WP_014477328.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. RO-NN-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2399805..2410179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I33_RS11860 (I33_2539) yqhG 2400133..2400927 (+) 795 WP_014477322.1 YqhG family protein -
  I33_RS11865 (I33_2540) sinI 2401111..2401284 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  I33_RS11870 (I33_2541) sinR 2401318..2401653 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  I33_RS11875 (I33_2542) tasA 2401745..2402530 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  I33_RS11880 (I33_2543) sipW 2402595..2403167 (-) 573 WP_014477325.1 signal peptidase I SipW -
  I33_RS11885 (I33_2544) tapA 2403151..2403912 (-) 762 WP_014477326.1 amyloid fiber anchoring/assembly protein TapA -
  I33_RS11890 (I33_2545) yqzG 2404186..2404512 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  I33_RS11895 (I33_2546) spoIITA 2404554..2404733 (-) 180 WP_014477327.1 YqzE family protein -
  I33_RS11900 (I33_2547) comGG 2404805..2405179 (-) 375 WP_014477328.1 ComG operon protein ComGG Machinery gene
  I33_RS11905 (I33_2548) comGF 2405180..2405563 (-) 384 WP_041519396.1 ComG operon protein ComGF Machinery gene
  I33_RS11910 (I33_2549) comGE 2405589..2405936 (-) 348 WP_014477330.1 ComG operon protein 5 Machinery gene
  I33_RS11915 (I33_2550) comGD 2405920..2406351 (-) 432 WP_014477331.1 comG operon protein ComGD Machinery gene
  I33_RS11920 (I33_2551) comGC 2406341..2406637 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  I33_RS11925 (I33_2552) comGB 2406651..2407688 (-) 1038 WP_014477333.1 comG operon protein ComGB Machinery gene
  I33_RS11930 (I33_2553) comGA 2407675..2408745 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  I33_RS11935 (I33_2555) corA 2409156..2410109 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14427.61 Da        Isoelectric Point: 9.5660

>NTDB_id=45415 I33_RS11900 WP_014477328.1 2404805..2405179(-) (comGG) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
MYRTGGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEERKGQKGTQQFPYGRVS
YYIHDTSVKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=45415 I33_RS11900 WP_014477328.1 2404805..2405179(-) (comGG) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
ATGTACCGTACGGGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTCCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGTCAGAAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGGTAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

94.355

100

0.944


Multiple sequence alignment