Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | I33_RS11865 | Genome accession | NC_017195 |
| Coordinates | 2401111..2401284 (+) | Length | 57 a.a. |
| NCBI ID | WP_014477323.1 | Uniprot ID | - |
| Organism | Bacillus subtilis subsp. subtilis str. RO-NN-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2396111..2406284
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I33_RS11850 (I33_2537) | gcvT | 2396909..2397997 (-) | 1089 | WP_014477320.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| I33_RS11855 (I33_2538) | hepAA | 2398439..2400112 (+) | 1674 | WP_014477321.1 | SNF2-related protein | - |
| I33_RS11860 (I33_2539) | yqhG | 2400133..2400927 (+) | 795 | WP_014477322.1 | YqhG family protein | - |
| I33_RS11865 (I33_2540) | sinI | 2401111..2401284 (+) | 174 | WP_014477323.1 | anti-repressor SinI | Regulator |
| I33_RS11870 (I33_2541) | sinR | 2401318..2401653 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| I33_RS11875 (I33_2542) | tasA | 2401745..2402530 (-) | 786 | WP_014477324.1 | biofilm matrix protein TasA | - |
| I33_RS11880 (I33_2543) | sipW | 2402595..2403167 (-) | 573 | WP_014477325.1 | signal peptidase I SipW | - |
| I33_RS11885 (I33_2544) | tapA | 2403151..2403912 (-) | 762 | WP_014477326.1 | amyloid fiber anchoring/assembly protein TapA | - |
| I33_RS11890 (I33_2545) | yqzG | 2404186..2404512 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| I33_RS11895 (I33_2546) | spoIITA | 2404554..2404733 (-) | 180 | WP_014477327.1 | YqzE family protein | - |
| I33_RS11900 (I33_2547) | comGG | 2404805..2405179 (-) | 375 | WP_014477328.1 | ComG operon protein ComGG | Machinery gene |
| I33_RS11905 (I33_2548) | comGF | 2405180..2405563 (-) | 384 | WP_041519396.1 | ComG operon protein ComGF | Machinery gene |
| I33_RS11910 (I33_2549) | comGE | 2405589..2405936 (-) | 348 | WP_014477330.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6633.58 Da Isoelectric Point: 6.7231
>NTDB_id=45413 I33_RS11865 WP_014477323.1 2401111..2401284(+) (sinI) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=45413 I33_RS11865 WP_014477323.1 2401111..2401284(+) (sinI) [Bacillus subtilis subsp. subtilis str. RO-NN-1]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
98.246 |
100 |
0.982 |