Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HT132_RS08675 Genome accession   NZ_CP054479
Coordinates   1680395..1680772 (+) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain R8-25     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1675395..1685772
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT132_RS08640 (HT132_08640) - 1675710..1676660 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  HT132_RS08645 (HT132_08645) comGA 1676853..1677923 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  HT132_RS08650 (HT132_08650) comGB 1677910..1678947 (+) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  HT132_RS08655 (HT132_08655) comGC 1678952..1679260 (+) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  HT132_RS08660 (HT132_08660) comGD 1679250..1679687 (+) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  HT132_RS08665 (HT132_08665) comGE 1679671..1679985 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  HT132_RS08670 (HT132_08670) comGF 1679999..1680394 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  HT132_RS08675 (HT132_08675) comGG 1680395..1680772 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  HT132_RS08680 (HT132_08680) - 1680829..1681008 (+) 180 WP_003153093.1 YqzE family protein -
  HT132_RS08685 (HT132_08685) - 1681049..1681378 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HT132_RS08690 (HT132_08690) tapA 1681637..1682308 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  HT132_RS08695 (HT132_08695) sipW 1682280..1682864 (+) 585 WP_174532489.1 signal peptidase I SipW -
  HT132_RS08700 (HT132_08700) tasA 1682929..1683714 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  HT132_RS08705 (HT132_08705) sinR 1683762..1684097 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HT132_RS08710 (HT132_08710) sinI 1684131..1684304 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  HT132_RS08715 (HT132_08715) - 1684481..1685275 (-) 795 WP_014418368.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=452778 HT132_RS08675 WP_017418138.1 1680395..1680772(+) (comGG) [Bacillus amyloliquefaciens strain R8-25]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=452778 HT132_RS08675 WP_017418138.1 1680395..1680772(+) (comGG) [Bacillus amyloliquefaciens strain R8-25]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512