Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HT132_RS08710 Genome accession   NZ_CP054479
Coordinates   1684131..1684304 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus amyloliquefaciens strain R8-25     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1679131..1689304
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT132_RS08660 (HT132_08660) comGD 1679250..1679687 (+) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  HT132_RS08665 (HT132_08665) comGE 1679671..1679985 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  HT132_RS08670 (HT132_08670) comGF 1679999..1680394 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  HT132_RS08675 (HT132_08675) comGG 1680395..1680772 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  HT132_RS08680 (HT132_08680) - 1680829..1681008 (+) 180 WP_003153093.1 YqzE family protein -
  HT132_RS08685 (HT132_08685) - 1681049..1681378 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HT132_RS08690 (HT132_08690) tapA 1681637..1682308 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  HT132_RS08695 (HT132_08695) sipW 1682280..1682864 (+) 585 WP_174532489.1 signal peptidase I SipW -
  HT132_RS08700 (HT132_08700) tasA 1682929..1683714 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  HT132_RS08705 (HT132_08705) sinR 1683762..1684097 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HT132_RS08710 (HT132_08710) sinI 1684131..1684304 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  HT132_RS08715 (HT132_08715) - 1684481..1685275 (-) 795 WP_014418368.1 YqhG family protein -
  HT132_RS08720 (HT132_08720) - 1685297..1686967 (-) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  HT132_RS08725 (HT132_08725) gcvT 1687391..1688491 (+) 1101 WP_021494308.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=452780 HT132_RS08710 WP_014418369.1 1684131..1684304(-) (sinI) [Bacillus amyloliquefaciens strain R8-25]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=452780 HT132_RS08710 WP_014418369.1 1684131..1684304(-) (sinI) [Bacillus amyloliquefaciens strain R8-25]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719