Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HT132_RS05640 Genome accession   NZ_CP054479
Coordinates   1111760..1111900 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain R8-25     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1106760..1116900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HT132_RS05615 (HT132_05615) - 1107063..1107461 (+) 399 WP_003152031.1 YueI family protein -
  HT132_RS05620 (HT132_05620) - 1107558..1108109 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  HT132_RS05625 (HT132_05625) - 1108127..1109593 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  HT132_RS05630 (HT132_05630) - 1109723..1110946 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  HT132_RS05635 (HT132_05635) - 1110953..1111294 (-) 342 WP_021495366.1 hypothetical protein -
  HT132_RS05640 (HT132_05640) degQ 1111760..1111900 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HT132_RS05645 (HT132_05645) - 1112085..1112963 (+) 879 WP_032860494.1 polyprenyl synthetase family protein -
  HT132_RS05650 (HT132_05650) comX 1112963..1113127 (+) 165 WP_007613432.1 competence pheromone ComX -
  HT132_RS05655 (HT132_05655) comP 1113139..1115430 (+) 2292 WP_099721970.1 histidine kinase Regulator
  HT132_RS05660 (HT132_05660) comA 1115511..1116155 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  HT132_RS05665 (HT132_05665) - 1116177..1116560 (+) 384 WP_104842774.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=452758 HT132_RS05640 WP_003152043.1 1111760..1111900(+) (degQ) [Bacillus amyloliquefaciens strain R8-25]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=452758 HT132_RS05640 WP_003152043.1 1111760..1111900(+) (degQ) [Bacillus amyloliquefaciens strain R8-25]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891