Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   I6I21_RS07265 Genome accession   NZ_CP065984
Coordinates   1441176..1441460 (+) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis strain FDAARGOS_1064     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1436176..1446460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6I21_RS07220 (I6I21_07220) - 1437360..1437596 (+) 237 WP_014570799.1 hypothetical protein -
  I6I21_RS07225 (I6I21_07225) - 1437609..1437959 (+) 351 WP_014570798.1 hypothetical protein -
  I6I21_RS07230 (I6I21_07230) - 1437972..1438271 (+) 300 WP_014570797.1 phage holin -
  I6I21_RS07235 (I6I21_07235) - 1438271..1439050 (+) 780 WP_014570796.1 peptidoglycan amidohydrolase family protein -
  I6I21_RS07240 (I6I21_07240) - 1439129..1439653 (+) 525 WP_014570795.1 GNAT family N-acetyltransferase -
  I6I21_RS07245 (I6I21_07245) comGC 1439800..1440069 (+) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  I6I21_RS07250 (I6I21_07250) comGD 1440029..1440460 (+) 432 WP_014570794.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6I21_RS07255 (I6I21_07255) comGE 1440432..1440728 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  I6I21_RS07260 (I6I21_07260) comGF 1440691..1441137 (+) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6I21_RS07265 (I6I21_07265) comGG 1441176..1441460 (+) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  I6I21_RS07270 (I6I21_07270) - 1441550..1441987 (+) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  I6I21_RS07275 (I6I21_07275) - 1441984..1442826 (+) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  I6I21_RS07280 (I6I21_07280) - 1443003..1443740 (+) 738 WP_003129989.1 metal ABC transporter ATP-binding protein -
  I6I21_RS07285 (I6I21_07285) - 1443733..1444542 (+) 810 WP_014570791.1 metal ABC transporter permease -
  I6I21_RS07290 (I6I21_07290) - 1444581..1445447 (-) 867 WP_003129984.1 RluA family pseudouridine synthase -
  I6I21_RS07295 (I6I21_07295) - 1445651..1446028 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=452653 I6I21_RS07265 WP_003129993.1 1441176..1441460(+) (comGG) [Lactococcus lactis strain FDAARGOS_1064]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=452653 I6I21_RS07265 WP_003129993.1 1441176..1441460(+) (comGG) [Lactococcus lactis strain FDAARGOS_1064]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585