Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HSX12_RS12040 Genome accession   NZ_CP054467
Coordinates   2483226..2483399 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CF57     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2478226..2488399
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HSX12_RS12025 (HSX12_11915) gcvT 2479039..2480139 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  HSX12_RS12030 (HSX12_11920) - 2480563..2482233 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  HSX12_RS12035 (HSX12_11925) - 2482255..2483049 (+) 795 WP_156240427.1 YqhG family protein -
  HSX12_RS12040 (HSX12_11930) sinI 2483226..2483399 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HSX12_RS12045 (HSX12_11935) sinR 2483433..2483768 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HSX12_RS12050 (HSX12_11940) tasA 2483816..2484601 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HSX12_RS12055 (HSX12_11945) sipW 2484666..2485250 (-) 585 WP_015240205.1 signal peptidase I SipW -
  HSX12_RS12060 (HSX12_11950) tapA 2485222..2485893 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  HSX12_RS12065 (HSX12_11955) - 2486152..2486481 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HSX12_RS12070 (HSX12_11960) - 2486521..2486700 (-) 180 WP_003153093.1 YqzE family protein -
  HSX12_RS12075 (HSX12_11965) comGG 2486757..2487134 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  HSX12_RS12080 (HSX12_11970) comGF 2487135..2487635 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  HSX12_RS12085 (HSX12_11975) comGE 2487544..2487858 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  HSX12_RS12090 (HSX12_11980) comGD 2487842..2488279 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=452622 HSX12_RS12040 WP_003153105.1 2483226..2483399(+) (sinI) [Bacillus velezensis strain CF57]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=452622 HSX12_RS12040 WP_003153105.1 2483226..2483399(+) (sinI) [Bacillus velezensis strain CF57]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702