Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HSX12_RS12040 | Genome accession | NZ_CP054467 |
| Coordinates | 2483226..2483399 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CF57 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2478226..2488399
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HSX12_RS12025 (HSX12_11915) | gcvT | 2479039..2480139 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HSX12_RS12030 (HSX12_11920) | - | 2480563..2482233 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| HSX12_RS12035 (HSX12_11925) | - | 2482255..2483049 (+) | 795 | WP_156240427.1 | YqhG family protein | - |
| HSX12_RS12040 (HSX12_11930) | sinI | 2483226..2483399 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| HSX12_RS12045 (HSX12_11935) | sinR | 2483433..2483768 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HSX12_RS12050 (HSX12_11940) | tasA | 2483816..2484601 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| HSX12_RS12055 (HSX12_11945) | sipW | 2484666..2485250 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| HSX12_RS12060 (HSX12_11950) | tapA | 2485222..2485893 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HSX12_RS12065 (HSX12_11955) | - | 2486152..2486481 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| HSX12_RS12070 (HSX12_11960) | - | 2486521..2486700 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| HSX12_RS12075 (HSX12_11965) | comGG | 2486757..2487134 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HSX12_RS12080 (HSX12_11970) | comGF | 2487135..2487635 (-) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| HSX12_RS12085 (HSX12_11975) | comGE | 2487544..2487858 (-) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| HSX12_RS12090 (HSX12_11980) | comGD | 2487842..2488279 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=452622 HSX12_RS12040 WP_003153105.1 2483226..2483399(+) (sinI) [Bacillus velezensis strain CF57]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=452622 HSX12_RS12040 WP_003153105.1 2483226..2483399(+) (sinI) [Bacillus velezensis strain CF57]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |