Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   I8N71_RS13315 Genome accession   NZ_CP065789
Coordinates   2552046..2552219 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain LBUM979     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547046..2557219
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N71_RS13300 (I8N71_13300) gcvT 2547845..2548933 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  I8N71_RS13305 (I8N71_13305) hepAA 2549375..2551048 (+) 1674 WP_004398544.1 SNF2-related protein -
  I8N71_RS13310 (I8N71_13310) yqhG 2551069..2551863 (+) 795 WP_003230200.1 YqhG family protein -
  I8N71_RS13315 (I8N71_13315) sinI 2552046..2552219 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  I8N71_RS13320 (I8N71_13320) sinR 2552253..2552588 (+) 336 WP_198082058.1 transcriptional regulator SinR Regulator
  I8N71_RS13325 (I8N71_13325) tasA 2552681..2553466 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  I8N71_RS13330 (I8N71_13330) sipW 2553530..2554102 (-) 573 WP_003246088.1 signal peptidase I SipW -
  I8N71_RS13335 (I8N71_13335) tapA 2554086..2554847 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  I8N71_RS13340 (I8N71_13340) yqzG 2555119..2555445 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  I8N71_RS13345 (I8N71_13345) spoIITA 2555487..2555666 (-) 180 WP_003230176.1 YqzE family protein -
  I8N71_RS13350 (I8N71_13350) comGG 2555737..2556111 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  I8N71_RS13355 (I8N71_13355) comGF 2556112..2556495 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  I8N71_RS13360 (I8N71_13360) comGE 2556521..2556868 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=451422 I8N71_RS13315 WP_003230187.1 2552046..2552219(+) (sinI) [Bacillus subtilis strain LBUM979]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=451422 I8N71_RS13315 WP_003230187.1 2552046..2552219(+) (sinI) [Bacillus subtilis strain LBUM979]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1