Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HPQ66_RS11460 Genome accession   NZ_CP053764
Coordinates   2436284..2436457 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain B268     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2431284..2441457
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPQ66_RS11445 (HPQ66_11485) gcvT 2432101..2433201 (-) 1101 WP_172614824.1 glycine cleavage system aminomethyltransferase GcvT -
  HPQ66_RS11450 (HPQ66_11490) - 2433625..2435295 (+) 1671 WP_128574830.1 DEAD/DEAH box helicase -
  HPQ66_RS11455 (HPQ66_11495) - 2435313..2436107 (+) 795 WP_014305407.1 YqhG family protein -
  HPQ66_RS11460 (HPQ66_11500) sinI 2436284..2436457 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HPQ66_RS11465 (HPQ66_11505) sinR 2436491..2436826 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HPQ66_RS11470 (HPQ66_11510) tasA 2436874..2437659 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HPQ66_RS11475 (HPQ66_11515) sipW 2437723..2438307 (-) 585 WP_012117977.1 signal peptidase I SipW -
  HPQ66_RS11480 (HPQ66_11520) tapA 2438279..2438950 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  HPQ66_RS11485 (HPQ66_11525) - 2439209..2439538 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HPQ66_RS11490 (HPQ66_11530) - 2439578..2439757 (-) 180 WP_003153093.1 YqzE family protein -
  HPQ66_RS11495 (HPQ66_11535) comGG 2439814..2440191 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HPQ66_RS11500 (HPQ66_11540) - 2440192..2440587 (-) 396 WP_172614825.1 ComGF family competence protein -
  HPQ66_RS11505 (HPQ66_11545) comGE 2440601..2440915 (-) 315 WP_146284356.1 competence type IV pilus minor pilin ComGE Machinery gene
  HPQ66_RS11510 (HPQ66_11550) comGD 2440899..2441336 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=446988 HPQ66_RS11460 WP_003153105.1 2436284..2436457(+) (sinI) [Bacillus velezensis strain B268]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=446988 HPQ66_RS11460 WP_003153105.1 2436284..2436457(+) (sinI) [Bacillus velezensis strain B268]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702