Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HPQ66_RS11460 | Genome accession | NZ_CP053764 |
| Coordinates | 2436284..2436457 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain B268 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2431284..2441457
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HPQ66_RS11445 (HPQ66_11485) | gcvT | 2432101..2433201 (-) | 1101 | WP_172614824.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HPQ66_RS11450 (HPQ66_11490) | - | 2433625..2435295 (+) | 1671 | WP_128574830.1 | DEAD/DEAH box helicase | - |
| HPQ66_RS11455 (HPQ66_11495) | - | 2435313..2436107 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| HPQ66_RS11460 (HPQ66_11500) | sinI | 2436284..2436457 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| HPQ66_RS11465 (HPQ66_11505) | sinR | 2436491..2436826 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HPQ66_RS11470 (HPQ66_11510) | tasA | 2436874..2437659 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| HPQ66_RS11475 (HPQ66_11515) | sipW | 2437723..2438307 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| HPQ66_RS11480 (HPQ66_11520) | tapA | 2438279..2438950 (-) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HPQ66_RS11485 (HPQ66_11525) | - | 2439209..2439538 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| HPQ66_RS11490 (HPQ66_11530) | - | 2439578..2439757 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| HPQ66_RS11495 (HPQ66_11535) | comGG | 2439814..2440191 (-) | 378 | WP_094247734.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HPQ66_RS11500 (HPQ66_11540) | - | 2440192..2440587 (-) | 396 | WP_172614825.1 | ComGF family competence protein | - |
| HPQ66_RS11505 (HPQ66_11545) | comGE | 2440601..2440915 (-) | 315 | WP_146284356.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| HPQ66_RS11510 (HPQ66_11550) | comGD | 2440899..2441336 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=446988 HPQ66_RS11460 WP_003153105.1 2436284..2436457(+) (sinI) [Bacillus velezensis strain B268]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=446988 HPQ66_RS11460 WP_003153105.1 2436284..2436457(+) (sinI) [Bacillus velezensis strain B268]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |