Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HPQ66_RS11505 Genome accession   NZ_CP053764
Coordinates   2440601..2440915 (-) Length   104 a.a.
NCBI ID   WP_146284356.1    Uniprot ID   -
Organism   Bacillus velezensis strain B268     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435601..2445915
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPQ66_RS11460 (HPQ66_11500) sinI 2436284..2436457 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HPQ66_RS11465 (HPQ66_11505) sinR 2436491..2436826 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HPQ66_RS11470 (HPQ66_11510) tasA 2436874..2437659 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HPQ66_RS11475 (HPQ66_11515) sipW 2437723..2438307 (-) 585 WP_012117977.1 signal peptidase I SipW -
  HPQ66_RS11480 (HPQ66_11520) tapA 2438279..2438950 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  HPQ66_RS11485 (HPQ66_11525) - 2439209..2439538 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HPQ66_RS11490 (HPQ66_11530) - 2439578..2439757 (-) 180 WP_003153093.1 YqzE family protein -
  HPQ66_RS11495 (HPQ66_11535) comGG 2439814..2440191 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  HPQ66_RS11500 (HPQ66_11540) - 2440192..2440587 (-) 396 WP_172614825.1 ComGF family competence protein -
  HPQ66_RS11505 (HPQ66_11545) comGE 2440601..2440915 (-) 315 WP_146284356.1 competence type IV pilus minor pilin ComGE Machinery gene
  HPQ66_RS11510 (HPQ66_11550) comGD 2440899..2441336 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  HPQ66_RS11515 (HPQ66_11555) comGC 2441326..2441634 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HPQ66_RS11520 (HPQ66_11560) comGB 2441639..2442676 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  HPQ66_RS11525 (HPQ66_11565) comGA 2442663..2443733 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  HPQ66_RS11530 (HPQ66_11570) - 2443925..2444875 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11874.87 Da        Isoelectric Point: 6.9470

>NTDB_id=446991 HPQ66_RS11505 WP_146284356.1 2440601..2440915(-) (comGE) [Bacillus velezensis strain B268]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPSVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=446991 HPQ66_RS11505 WP_146284356.1 2440601..2440915(-) (comGE) [Bacillus velezensis strain B268]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAGC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCAGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481