Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HK440_RS01135 Genome accession   NZ_CP053396
Coordinates   249912..250025 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori strain HPY     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 244912..255025
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HK440_RS01110 (HK440_01110) - 244971..247190 (+) 2220 WP_001916850.1 ATP-dependent Clp protease ATP-binding subunit -
  HK440_RS01115 (HK440_01115) panD 247180..247533 (+) 354 WP_001916849.1 aspartate 1-decarboxylase -
  HK440_RS01120 (HK440_01120) - 247536..247838 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HK440_RS01125 (HK440_01125) - 247838..248833 (+) 996 WP_001916848.1 PDZ domain-containing protein -
  HK440_RS01130 (HK440_01130) comB6 248841..249896 (+) 1056 WP_171407256.1 P-type conjugative transfer protein TrbL Machinery gene
  HK440_RS01135 (HK440_01135) comB7 249912..250025 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HK440_RS01140 (HK440_01140) comB8 250022..250759 (+) 738 WP_001916845.1 virB8 family protein Machinery gene
  HK440_RS01145 (HK440_01145) comB9 250759..251736 (+) 978 WP_001916844.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HK440_RS01150 (HK440_01150) comB10 251729..252865 (+) 1137 WP_001916843.1 DNA type IV secretion system protein ComB10 Machinery gene
  HK440_RS01155 (HK440_01155) - 252936..254348 (+) 1413 WP_001916842.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=444770 HK440_RS01135 WP_001217868.1 249912..250025(+) (comB7) [Helicobacter pylori strain HPY]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=444770 HK440_RS01135 WP_001217868.1 249912..250025(+) (comB7) [Helicobacter pylori strain HPY]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919