Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HNO13_RS11910 Genome accession   NZ_CP053377
Coordinates   2510481..2510858 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain EN01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2505481..2515858
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO13_RS11870 (HNO13_11905) - 2505979..2506773 (+) 795 WP_003153106.1 YqhG family protein -
  HNO13_RS11875 (HNO13_11910) sinI 2506950..2507123 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HNO13_RS11880 (HNO13_11915) sinR 2507157..2507492 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNO13_RS11885 (HNO13_11920) tasA 2507540..2508325 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  HNO13_RS11890 (HNO13_11925) sipW 2508389..2508973 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HNO13_RS11895 (HNO13_11930) tapA 2508945..2509616 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  HNO13_RS11900 (HNO13_11935) - 2509876..2510205 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  HNO13_RS11905 (HNO13_11940) - 2510245..2510424 (-) 180 WP_003153093.1 YqzE family protein -
  HNO13_RS11910 (HNO13_11945) comGG 2510481..2510858 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNO13_RS11915 (HNO13_11950) comGF 2510859..2511359 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  HNO13_RS11920 (HNO13_11955) comGE 2511268..2511582 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNO13_RS11925 (HNO13_11960) comGD 2511566..2512003 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  HNO13_RS11930 (HNO13_11965) comGC 2511993..2512301 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HNO13_RS11935 (HNO13_11970) comGB 2512306..2513343 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  HNO13_RS11940 (HNO13_11975) comGA 2513330..2514400 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HNO13_RS11945 (HNO13_11980) - 2514592..2515542 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=444549 HNO13_RS11910 WP_003153092.1 2510481..2510858(-) (comGG) [Bacillus velezensis strain EN01]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=444549 HNO13_RS11910 WP_003153092.1 2510481..2510858(-) (comGG) [Bacillus velezensis strain EN01]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512