Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HNO13_RS11920 Genome accession   NZ_CP053377
Coordinates   2511268..2511582 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain EN01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2506268..2516582
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO13_RS11875 (HNO13_11910) sinI 2506950..2507123 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HNO13_RS11880 (HNO13_11915) sinR 2507157..2507492 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNO13_RS11885 (HNO13_11920) tasA 2507540..2508325 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  HNO13_RS11890 (HNO13_11925) sipW 2508389..2508973 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HNO13_RS11895 (HNO13_11930) tapA 2508945..2509616 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  HNO13_RS11900 (HNO13_11935) - 2509876..2510205 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  HNO13_RS11905 (HNO13_11940) - 2510245..2510424 (-) 180 WP_003153093.1 YqzE family protein -
  HNO13_RS11910 (HNO13_11945) comGG 2510481..2510858 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNO13_RS11915 (HNO13_11950) comGF 2510859..2511359 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  HNO13_RS11920 (HNO13_11955) comGE 2511268..2511582 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNO13_RS11925 (HNO13_11960) comGD 2511566..2512003 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  HNO13_RS11930 (HNO13_11965) comGC 2511993..2512301 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HNO13_RS11935 (HNO13_11970) comGB 2512306..2513343 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  HNO13_RS11940 (HNO13_11975) comGA 2513330..2514400 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HNO13_RS11945 (HNO13_11980) - 2514592..2515542 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=444550 HNO13_RS11920 WP_015388003.1 2511268..2511582(-) (comGE) [Bacillus velezensis strain EN01]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=444550 HNO13_RS11920 WP_015388003.1 2511268..2511582(-) (comGE) [Bacillus velezensis strain EN01]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481