Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HNO13_RS11875 Genome accession   NZ_CP053377
Coordinates   2506950..2507123 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain EN01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2501950..2512123
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HNO13_RS11860 (HNO13_11895) gcvT 2502765..2503865 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  HNO13_RS11865 (HNO13_11900) - 2504291..2505961 (+) 1671 WP_003153107.1 SNF2-related protein -
  HNO13_RS11870 (HNO13_11905) - 2505979..2506773 (+) 795 WP_003153106.1 YqhG family protein -
  HNO13_RS11875 (HNO13_11910) sinI 2506950..2507123 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HNO13_RS11880 (HNO13_11915) sinR 2507157..2507492 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HNO13_RS11885 (HNO13_11920) tasA 2507540..2508325 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  HNO13_RS11890 (HNO13_11925) sipW 2508389..2508973 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HNO13_RS11895 (HNO13_11930) tapA 2508945..2509616 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  HNO13_RS11900 (HNO13_11935) - 2509876..2510205 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  HNO13_RS11905 (HNO13_11940) - 2510245..2510424 (-) 180 WP_003153093.1 YqzE family protein -
  HNO13_RS11910 (HNO13_11945) comGG 2510481..2510858 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HNO13_RS11915 (HNO13_11950) comGF 2510859..2511359 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  HNO13_RS11920 (HNO13_11955) comGE 2511268..2511582 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  HNO13_RS11925 (HNO13_11960) comGD 2511566..2512003 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=444547 HNO13_RS11875 WP_003153105.1 2506950..2507123(+) (sinI) [Bacillus velezensis strain EN01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=444547 HNO13_RS11875 WP_003153105.1 2506950..2507123(+) (sinI) [Bacillus velezensis strain EN01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702