Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   HHX45_RS00045 Genome accession   NZ_CP053343
Coordinates   10233..10751 (+) Length   172 a.a.
NCBI ID   WP_003624902.1    Uniprot ID   -
Organism   Lactobacillus helveticus strain LH2020     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2507..47924 10233..10751 within 0
IScluster/Tn 11210..16314 10233..10751 flank 459


Gene organization within MGE regions


Location: 2507..47924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HHX45_RS00015 (HHX45_00015) dnaN 2507..3637 (+) 1131 WP_012211194.1 DNA polymerase III subunit beta -
  HHX45_RS00020 (HHX45_00020) yaaA 3864..4088 (+) 225 WP_003624913.1 S4 domain-containing protein YaaA -
  HHX45_RS00025 (HHX45_00025) recF 4088..5215 (+) 1128 WP_025283128.1 DNA replication/repair protein RecF -
  HHX45_RS00030 (HHX45_00030) gyrB 5216..7180 (+) 1965 WP_012211197.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  HHX45_RS00035 (HHX45_00035) gyrA 7191..9674 (+) 2484 WP_103658416.1 DNA gyrase subunit A -
  HHX45_RS00040 (HHX45_00040) rpsF 9892..10188 (+) 297 WP_003628006.1 30S ribosomal protein S6 -
  HHX45_RS00045 (HHX45_00045) ssb 10233..10751 (+) 519 WP_003624902.1 single-stranded DNA-binding protein Machinery gene
  HHX45_RS00050 (HHX45_00050) rpsR 10779..11012 (+) 234 WP_003628008.1 30S ribosomal protein S18 -
  HHX45_RS00055 (HHX45_00055) - 11210..12429 (+) 1220 Protein_10 ISL3 family transposase -
  HHX45_RS00060 (HHX45_00060) - 13099..14691 (-) 1593 WP_003624897.1 ABC transporter ATP-binding protein -
  HHX45_RS00065 (HHX45_00065) - 14669..15160 (-) 492 WP_103659007.1 lanthionine synthetase LanC family protein -
  HHX45_RS00070 (HHX45_00070) - 15401..15865 (-) 465 Protein_13 IS982 family transposase -
  HHX45_RS00075 (HHX45_00075) - 15904..16338 (-) 435 Protein_14 IS30-like element ISLjo1 family transposase -
  HHX45_RS00080 (HHX45_00080) - 16470..16835 (+) 366 WP_020828863.1 hypothetical protein -
  HHX45_RS00085 (HHX45_00085) - 16974..18995 (+) 2022 WP_103658969.1 DHH family phosphoesterase -
  HHX45_RS00090 (HHX45_00090) rplI 19007..19462 (+) 456 WP_003624877.1 50S ribosomal protein L9 -
  HHX45_RS00095 (HHX45_00095) dnaB 19493..20887 (+) 1395 WP_103658973.1 replicative DNA helicase -
  HHX45_RS00100 (HHX45_00100) phnD 21122..22051 (+) 930 WP_103658975.1 phosphate/phosphite/phosphonate ABC transporter substrate-binding protein -
  HHX45_RS00105 (HHX45_00105) - 22168..23407 (-) 1240 Protein_20 ISL3 family transposase -
  HHX45_RS00110 (HHX45_00110) - 23574..24503 (+) 930 WP_103658707.1 DegV family protein -
  HHX45_RS00115 (HHX45_00115) - 24623..25501 (+) 879 WP_103658709.1 ROK family protein -
  HHX45_RS00120 (HHX45_00120) - 25653..25823 (+) 171 WP_003631748.1 CsbD family protein -
  HHX45_RS00125 (HHX45_00125) - 25874..26134 (+) 261 WP_046813737.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  HHX45_RS00130 (HHX45_00130) - 26195..27446 (-) 1252 Protein_25 DUF2974 domain-containing protein -
  HHX45_RS00135 (HHX45_00135) - 27530..28234 (-) 705 WP_201725370.1 MgtC/SapB family protein -
  HHX45_RS00145 (HHX45_00145) - 28604..28840 (+) 237 WP_103658715.1 hypothetical protein -
  HHX45_RS00150 (HHX45_00150) - 28908..29399 (-) 492 WP_268804770.1 DUF3278 domain-containing protein -
  HHX45_RS00155 (HHX45_00155) - 29429..29629 (-) 201 WP_003624837.1 helix-turn-helix transcriptional regulator -
  HHX45_RS00160 (HHX45_00160) - 29798..30436 (+) 639 WP_103658717.1 ATP-binding cassette domain-containing protein -
  HHX45_RS00165 (HHX45_00165) fetB 30433..31191 (+) 759 WP_003624831.1 iron export ABC transporter permease subunit FetB -
  HHX45_RS10270 - 31340..32209 (+) 870 WP_234993447.1 hypothetical protein -
  HHX45_RS10275 - 32219..32443 (+) 225 WP_003631201.1 hypothetical protein -
  HHX45_RS00180 (HHX45_00180) - 32518..33042 (+) 525 WP_308417949.1 TetR/AcrR family transcriptional regulator -
  HHX45_RS00185 (HHX45_00185) - 33146..34447 (+) 1302 WP_012211214.1 restriction endonuclease -
  HHX45_RS00190 (HHX45_00190) - 34527..35931 (+) 1405 Protein_36 C69 family dipeptidase -
  HHX45_RS00195 (HHX45_00195) - 35994..37388 (+) 1395 WP_003627964.1 IS3 family transposase -
  HHX45_RS00200 (HHX45_00200) - 37606..38985 (+) 1380 WP_236743680.1 LPXTG cell wall anchor domain-containing protein -
  HHX45_RS00205 (HHX45_00205) - 39082..39855 (+) 774 WP_201725377.1 putative ABC transporter permease -
  HHX45_RS00210 (HHX45_00210) - 39894..40394 (-) 501 WP_234993440.1 cob(I)yrinic acid a,c-diamide adenosyltransferase -
  HHX45_RS00215 (HHX45_00215) - 40455..40979 (-) 525 WP_025283142.1 ECF transporter S component -
  HHX45_RS00220 (HHX45_00220) - 40991..41389 (-) 399 WP_046813743.1 DUF4430 domain-containing protein -
  HHX45_RS10830 (HHX45_00225) - 41445..41525 (-) 81 Protein_43 ECF transporter S component -
  HHX45_RS00225 (HHX45_00230) - 41537..41935 (-) 399 WP_103658675.1 DUF4430 domain-containing protein -
  HHX45_RS00230 (HHX45_00235) nrdJ 41956..44190 (-) 2235 WP_025283144.1 ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent -
  HHX45_RS00235 (HHX45_00240) - 44444..45478 (+) 1035 WP_103658673.1 AI-2E family transporter -
  HHX45_RS00240 (HHX45_00245) - 45475..46047 (+) 573 WP_103658671.1 SGNH/GDSL hydrolase family protein -
  HHX45_RS00245 (HHX45_00250) - 46076..46258 (-) 183 WP_046813746.1 hypothetical protein -
  HHX45_RS00250 (HHX45_00255) - 46436..46789 (-) 354 WP_025283146.1 hypothetical protein -
  HHX45_RS00255 (HHX45_00260) - 47163..47924 (-) 762 WP_103658669.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 172 a.a.        Molecular weight: 18730.30 Da        Isoelectric Point: 4.6034

>NTDB_id=444148 HHX45_RS00045 WP_003624902.1 10233..10751(+) (ssb) [Lactobacillus helveticus strain LH2020]
MINRVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNSQGERDADFISCVIWRKSAENFCNFTSKGSLVGIDGRIQTR
SYDNKDGQRVYVTEVVVDNFALLESRKDREARGQNGGYTPNTGNAGAPSTNNFQNNGGSQNNAQNNNQSNNAQDPFAGSG
DPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=444148 HHX45_RS00045 WP_003624902.1 10233..10751(+) (ssb) [Lactobacillus helveticus strain LH2020]
ATGATTAATAGAGTTGTACTTGTTGGCCGTTTAACACGTGATCCTGAATTGCGTACTACTGGGAGTGGAATCTCGGTTGC
TACGTTTACTCTTGCTGTTGACCGTCAATTTACAAATAGCCAAGGTGAGAGGGACGCAGACTTTATCAGCTGTGTAATTT
GGAGGAAATCTGCAGAAAACTTCTGTAATTTTACTTCAAAGGGTTCATTGGTTGGTATTGATGGCCGTATTCAAACCAGA
AGTTATGACAATAAAGATGGGCAAAGAGTATATGTAACTGAAGTTGTCGTTGATAACTTCGCATTGCTCGAATCACGCAA
GGATCGTGAAGCCCGCGGTCAAAATGGTGGTTATACACCAAACACTGGAAATGCTGGTGCACCAAGCACTAACAACTTCC
AAAATAATGGTGGATCACAAAATAATGCTCAGAATAATAATCAATCAAACAACGCTCAAGATCCATTTGCAGGCTCTGGC
GATCCAATTGATATTTCTGATGATGATCTTCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.335

100

0.628
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.545

100

0.558
  ssb Glaesserella parasuis strain SC1401

34.807

100

0.366