Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   HIR76_RS13420 Genome accession   NZ_CP051860
Coordinates   2580622..2581005 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2575622..2586005
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIR76_RS13375 (HIR76_14230) sinI 2575912..2576085 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HIR76_RS13380 (HIR76_14225) sinR 2576119..2576454 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HIR76_RS13385 (HIR76_14220) aph(3')-IIIa 2576692..2577486 (-) 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
  HIR76_RS13390 (HIR76_14215) - 2577579..2578068 (-) 490 Protein_2604 GNAT family N-acetyltransferase -
  HIR76_RS13395 (HIR76_14210) sipW 2578040..2578612 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HIR76_RS13400 (HIR76_14205) tapA 2578596..2579357 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HIR76_RS13405 (HIR76_14200) yqzG 2579629..2579955 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HIR76_RS13410 (HIR76_14195) spoIITA 2579997..2580176 (-) 180 WP_003230176.1 YqzE family protein -
  HIR76_RS13415 (HIR76_14190) comGG 2580247..2580621 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HIR76_RS13420 (HIR76_14185) comGF 2580622..2581005 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  HIR76_RS13425 (HIR76_14180) comGE 2581031..2581378 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HIR76_RS13430 (HIR76_14175) comGD 2581362..2581793 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  HIR76_RS13435 (HIR76_14170) comGC 2581783..2582079 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  HIR76_RS13440 (HIR76_14165) comGB 2582093..2583130 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  HIR76_RS13445 (HIR76_14160) comGA 2583117..2584187 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HIR76_RS13450 (HIR76_14155) corA 2584599..2585552 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=441064 HIR76_RS13420 WP_003230168.1 2580622..2581005(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=441064 HIR76_RS13420 WP_003230168.1 2580622..2581005(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1