Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG576_RS00205 Genome accession   NZ_CP051539
Coordinates   36888..37001 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain LIM-003     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 31888..42001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG576_RS00180 (HG576_00180) - 31933..34158 (+) 2226 WP_202138901.1 ATP-dependent Clp protease ATP-binding subunit -
  HG576_RS00185 (HG576_00185) panD 34148..34501 (+) 354 WP_000142277.1 aspartate 1-decarboxylase -
  HG576_RS00190 (HG576_00190) - 34504..34806 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HG576_RS00195 (HG576_00195) - 34806..35810 (+) 1005 WP_202139214.1 PDZ domain-containing protein -
  HG576_RS00200 (HG576_00200) - 35818..36872 (+) 1055 Protein_33 P-type conjugative transfer protein TrbL -
  HG576_RS00205 (HG576_00205) comB7 36888..37001 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HG576_RS00210 (HG576_00210) comB8 36998..37735 (+) 738 WP_029650095.1 virB8 family protein Machinery gene
  HG576_RS00215 (HG576_00215) comB9 37735..38709 (+) 975 WP_078240866.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG576_RS00220 (HG576_00220) comB10 38702..39832 (+) 1131 WP_077654994.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG576_RS00225 (HG576_00225) - 39903..41315 (+) 1413 WP_078249663.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=439635 HG576_RS00205 WP_001217873.1 36888..37001(+) (comB7) [Helicobacter pylori strain LIM-003]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439635 HG576_RS00205 WP_001217873.1 36888..37001(+) (comB7) [Helicobacter pylori strain LIM-003]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1