Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG558_RS00200 Genome accession   NZ_CP051509
Coordinates   35550..35663 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain ASHA-009     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 30550..40663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG558_RS00175 (HG558_00175) - 30601..32823 (+) 2223 WP_202166719.1 ATP-dependent Clp protease ATP-binding subunit -
  HG558_RS00180 (HG558_00180) panD 32813..33163 (+) 351 WP_202166720.1 aspartate 1-decarboxylase -
  HG558_RS00185 (HG558_00185) - 33174..33476 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HG558_RS00190 (HG558_00190) - 33476..34471 (+) 996 WP_202166721.1 PDZ domain-containing protein -
  HG558_RS00195 (HG558_00195) comB6 34479..35534 (+) 1056 WP_202167069.1 P-type conjugative transfer protein TrbL Machinery gene
  HG558_RS00200 (HG558_00200) comB7 35550..35663 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HG558_RS00205 (HG558_00205) comB8 35660..36403 (+) 744 WP_202166722.1 virB8 family protein Machinery gene
  HG558_RS00210 (HG558_00210) comB9 36403..37368 (+) 966 WP_202166723.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG558_RS00215 (HG558_00215) comB10 37361..38497 (+) 1137 WP_202166724.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG558_RS00220 (HG558_00220) - 38567..39979 (+) 1413 WP_202166725.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=439368 HG558_RS00200 WP_001218100.1 35550..35663(+) (comB7) [Helicobacter pylori strain ASHA-009]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439368 HG558_RS00200 WP_001218100.1 35550..35663(+) (comB7) [Helicobacter pylori strain ASHA-009]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892