Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG562_RS00200 Genome accession   NZ_CP051505
Coordinates   35542..35655 (+) Length   37 a.a.
NCBI ID   WP_001217864.1    Uniprot ID   A0A0E0W910
Organism   Helicobacter pylori strain SHIM-010     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 30542..40655
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG562_RS00175 (HG562_00175) - 30604..32826 (+) 2223 WP_001051544.1 ATP-dependent Clp protease ATP-binding subunit -
  HG562_RS00180 (HG562_00180) panD 32816..33166 (+) 351 WP_000142269.1 aspartate 1-decarboxylase -
  HG562_RS00185 (HG562_00185) - 33177..33470 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG562_RS00190 (HG562_00190) - 33470..34465 (+) 996 WP_000468441.1 PDZ domain-containing protein -
  HG562_RS00195 (HG562_00195) comB6 34471..35526 (+) 1056 WP_000786694.1 P-type conjugative transfer protein TrbL Machinery gene
  HG562_RS00200 (HG562_00200) comB7 35542..35655 (+) 114 WP_001217864.1 hypothetical protein Machinery gene
  HG562_RS00205 (HG562_00205) comB8 35652..36395 (+) 744 WP_000660502.1 virB8 family protein Machinery gene
  HG562_RS00210 (HG562_00210) comB9 36395..37351 (+) 957 WP_014662053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG562_RS00215 (HG562_00215) comB10 37344..38480 (+) 1137 WP_001045868.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG562_RS00220 (HG562_00220) - 38552..39964 (+) 1413 WP_000694836.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=439281 HG562_RS00200 WP_001217864.1 35542..35655(+) (comB7) [Helicobacter pylori strain SHIM-010]
MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439281 HG562_RS00200 WP_001217864.1 35542..35655(+) (comB7) [Helicobacter pylori strain SHIM-010]
ATGAGAATTTTTTTTGTTATTATAGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0E0W910

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892