Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG565_RS00200 Genome accession   NZ_CP051502
Coordinates   33318..33431 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori strain PUNO-001     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 28318..38431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG565_RS00175 (HG565_00175) - 28369..30591 (+) 2223 WP_202169509.1 ATP-dependent Clp protease ATP-binding subunit -
  HG565_RS00180 (HG565_00180) panD 30581..30931 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HG565_RS00185 (HG565_00185) - 30942..31244 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HG565_RS00190 (HG565_00190) - 31244..32239 (+) 996 WP_202169987.1 PDZ domain-containing protein -
  HG565_RS00195 (HG565_00195) comB6 32247..33302 (+) 1056 WP_202169986.1 P-type conjugative transfer protein TrbL Machinery gene
  HG565_RS00200 (HG565_00200) comB7 33318..33431 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HG565_RS00205 (HG565_00205) comB8 33428..34168 (+) 741 WP_202169510.1 virB8 family protein Machinery gene
  HG565_RS00210 (HG565_00210) comB9 34168..35130 (+) 963 WP_202169511.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG565_RS00215 (HG565_00215) comB10 35123..36259 (+) 1137 WP_202169512.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG565_RS00220 (HG565_00220) - 36329..37741 (+) 1413 WP_202169513.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=439218 HG565_RS00200 WP_001217868.1 33318..33431(+) (comB7) [Helicobacter pylori strain PUNO-001]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=439218 HG565_RS00200 WP_001217868.1 33318..33431(+) (comB7) [Helicobacter pylori strain PUNO-001]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919