Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HG566_RS00195 Genome accession   NZ_CP051501
Coordinates   33416..33541 (+) Length   41 a.a.
NCBI ID   WP_202164568.1    Uniprot ID   -
Organism   Helicobacter pylori strain PUNO-002     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 28416..38541
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG566_RS00170 (HG566_00170) - 28461..30683 (+) 2223 WP_202164566.1 ATP-dependent Clp protease ATP-binding subunit -
  HG566_RS00175 (HG566_00175) panD 30673..31023 (+) 351 WP_202164567.1 aspartate 1-decarboxylase -
  HG566_RS00180 (HG566_00180) - 31034..31327 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HG566_RS00185 (HG566_00185) - 31327..32337 (+) 1011 WP_202165270.1 PDZ domain-containing protein -
  HG566_RS00190 (HG566_00190) comB6 32345..33400 (+) 1056 WP_202165268.1 P-type conjugative transfer protein TrbL Machinery gene
  HG566_RS00195 (HG566_00195) comB7 33416..33541 (+) 126 WP_202164568.1 comB7 lipoprotein Machinery gene
  HG566_RS00200 (HG566_00200) comB8 33538..34281 (+) 744 WP_202164569.1 virB8 family protein Machinery gene
  HG566_RS00205 (HG566_00205) comB9 34281..35246 (+) 966 WP_202164570.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG566_RS00210 (HG566_00210) comB10 35239..36375 (+) 1137 WP_202164571.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG566_RS00215 (HG566_00215) - 36445..37857 (+) 1413 WP_202164572.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4755.85 Da        Isoelectric Point: 10.6203

>NTDB_id=439197 HG566_RS00195 WP_202164568.1 33416..33541(+) (comB7) [Helicobacter pylori strain PUNO-002]
MRIFFVIMGLILFGCTSKVHEMKKSPCALHEKLHKNRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=439197 HG566_RS00195 WP_202164568.1 33416..33541(+) (comB7) [Helicobacter pylori strain PUNO-002]
ATGAGAATTTTTTTTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CGCGTTGCATGAAAAGTTACATAAAAATAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805