Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   HGO94_RS13860 Genome accession   NZ_CP051483
Coordinates   2794406..2794876 (+) Length   156 a.a.
NCBI ID   WP_138076570.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NGA66a     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2765698..2801384 2794406..2794876 within 0


Gene organization within MGE regions


Location: 2765698..2801384
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HGO94_RS13670 (HGO94_10725) - 2765698..2766324 (-) 627 WP_000522384.1 nitroreductase family protein -
  HGO94_RS13675 (HGO94_10730) - 2766521..2767702 (+) 1182 WP_000120303.1 SdrH family protein -
  HGO94_RS13680 (HGO94_10735) mroQ 2767727..2768470 (-) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  HGO94_RS13685 (HGO94_10740) groES 2768645..2768929 (+) 285 WP_000917289.1 co-chaperone GroES -
  HGO94_RS13690 (HGO94_10745) groL 2769005..2770621 (+) 1617 WP_000240642.1 chaperonin GroEL -
  HGO94_RS13695 (HGO94_10750) - 2770716..2771262 (-) 547 Protein_2659 site-specific integrase -
  HGO94_RS13700 (HGO94_10755) - 2771323..2771535 (+) 213 WP_000128898.1 hypothetical protein -
  HGO94_RS13705 (HGO94_10760) - 2771532..2772122 (+) 591 WP_001293059.1 terminase small subunit -
  HGO94_RS13710 (HGO94_10765) - 2772439..2772876 (+) 438 WP_072419900.1 hypothetical protein -
  HGO94_RS13715 (HGO94_10770) - 2772982..2773425 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  HGO94_RS13720 (HGO94_10775) - 2774279..2775586 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  HGO94_RS13725 (HGO94_10780) - 2775747..2776658 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  HGO94_RS13730 (HGO94_10785) - 2776720..2777565 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  HGO94_RS13735 (HGO94_10790) - 2777937..2779160 (-) 1224 WP_000206623.1 ArgE/DapE family deacylase -
  HGO94_RS13740 (HGO94_10795) lukH 2779596..2780648 (+) 1053 WP_000791417.1 bi-component leukocidin LukGH subunit H -
  HGO94_RS13745 (HGO94_10800) lukG 2780670..2781686 (+) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  HGO94_RS13750 (HGO94_10805) sph 2781924..2782754 (-) 831 Protein_2670 sphingomyelin phosphodiesterase -
  HGO94_RS13755 (HGO94_10810) - 2782805..2783842 (-) 1038 WP_000857191.1 site-specific integrase -
  HGO94_RS13760 (HGO94_10815) - 2783901..2784365 (-) 465 WP_000825947.1 hypothetical protein -
  HGO94_RS13765 (HGO94_10820) - 2784465..2784647 (-) 183 WP_000705248.1 hypothetical protein -
  HGO94_RS13770 (HGO94_10825) - 2784692..2785549 (-) 858 WP_000804507.1 HIRAN domain-containing protein -
  HGO94_RS13775 (HGO94_10830) - 2785561..2786277 (-) 717 WP_001083967.1 LexA family transcriptional regulator -
  HGO94_RS13780 (HGO94_10835) - 2786441..2786683 (+) 243 WP_000639927.1 DUF739 family protein -
  HGO94_RS13785 (HGO94_10840) - 2786697..2786957 (+) 261 WP_000435341.1 transcriptional regulator -
  HGO94_RS13790 (HGO94_10845) - 2786981..2787520 (-) 540 WP_000351243.1 hypothetical protein -
  HGO94_RS13795 (HGO94_10850) - 2787577..2788332 (+) 756 WP_001148342.1 phage antirepressor KilAC domain-containing protein -
  HGO94_RS13800 (HGO94_10855) - 2788348..2788542 (+) 195 WP_001566738.1 hypothetical protein -
  HGO94_RS13805 (HGO94_10860) - 2788537..2788893 (-) 357 WP_000768245.1 DUF2513 domain-containing protein -
  HGO94_RS13810 (HGO94_10865) - 2788943..2789134 (+) 192 WP_000389905.1 hypothetical protein -
  HGO94_RS13815 (HGO94_10870) - 2789136..2789363 (-) 228 WP_000801108.1 hypothetical protein -
  HGO94_RS13820 (HGO94_10875) - 2789422..2789742 (+) 321 WP_249741395.1 DUF771 domain-containing protein -
  HGO94_RS13825 (HGO94_10880) - 2789739..2789897 (+) 159 WP_249741396.1 DUF1270 family protein -
  HGO94_RS13830 (HGO94_10885) - 2789994..2790296 (+) 303 WP_044131919.1 DUF2482 family protein -
  HGO94_RS13835 (HGO94_10890) - 2790301..2790561 (+) 261 WP_031763794.1 DUF1108 family protein -
  HGO94_RS13840 (HGO94_10895) - 2790570..2790833 (+) 264 WP_001205732.1 hypothetical protein -
  HGO94_RS13845 (HGO94_10900) - 2790830..2792785 (+) 1956 WP_048657537.1 AAA family ATPase -
  HGO94_RS13850 (HGO94_10905) - 2792787..2793707 (+) 921 WP_000138479.1 recombinase RecT -
  HGO94_RS13855 (HGO94_10910) - 2793788..2794405 (+) 618 WP_249741440.1 MBL fold metallo-hydrolase -
  HGO94_RS13860 (HGO94_10915) ssbA 2794406..2794876 (+) 471 WP_138076570.1 single-stranded DNA-binding protein Machinery gene
  HGO94_RS13865 (HGO94_10920) - 2794906..2795790 (+) 885 WP_047213628.1 DnaD domain protein -
  HGO94_RS13870 (HGO94_10925) - 2795797..2796015 (+) 219 WP_000338528.1 hypothetical protein -
  HGO94_RS13875 (HGO94_10930) - 2796024..2796428 (+) 405 WP_249741397.1 RusA family crossover junction endodeoxyribonuclease -
  HGO94_RS13880 (HGO94_10935) - 2796441..2796809 (+) 369 WP_249741398.1 SA1788 family PVL leukocidin-associated protein -
  HGO94_RS13885 (HGO94_10940) - 2796813..2797055 (+) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  HGO94_RS13890 (HGO94_10945) - 2797120..2797569 (+) 450 WP_031900917.1 YopX family protein -
  HGO94_RS13895 (HGO94_10950) - 2797566..2798075 (+) 510 WP_001105598.1 hypothetical protein -
  HGO94_RS13900 (HGO94_10955) - 2798072..2798482 (+) 411 WP_054193060.1 hypothetical protein -
  HGO94_RS13905 (HGO94_10960) - 2798475..2799011 (+) 537 WP_001066444.1 dUTPase -
  HGO94_RS13910 (HGO94_10965) - 2799048..2799254 (+) 207 WP_000195820.1 DUF1381 domain-containing protein -
  HGO94_RS13915 (HGO94_10970) - 2799251..2799400 (+) 150 WP_000595265.1 transcriptional activator RinB -
  HGO94_RS13920 (HGO94_10975) - 2799559..2800209 (+) 651 WP_001005262.1 hypothetical protein -
  HGO94_RS13925 (HGO94_10980) - 2800209..2800409 (+) 201 WP_000265041.1 DUF1514 family protein -
  HGO94_RS13930 (HGO94_10985) - 2800437..2800853 (+) 417 WP_000590126.1 hypothetical protein -
  HGO94_RS13935 (HGO94_10990) - 2801085..2801384 (+) 300 WP_000988336.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17653.57 Da        Isoelectric Point: 5.2672

>NTDB_id=438892 HGO94_RS13860 WP_138076570.1 2794406..2794876(+) (ssbA) [Staphylococcus aureus strain NGA66a]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVFVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=438892 HGO94_RS13860 WP_138076570.1 2794406..2794876(+) (ssbA) [Staphylococcus aureus strain NGA66a]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTCGATGGCAGATTACAAACGCGT
AATTATGAAAATAAGGAAGGTCAACGTGTGTTTGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

67.949

0.397