Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   HGO93_RS14045 Genome accession   NZ_CP051482
Coordinates   2836537..2837007 (+) Length   156 a.a.
NCBI ID   WP_138076570.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NGA104a     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2810625..2842754 2836537..2837007 within 0


Gene organization within MGE regions


Location: 2810625..2842754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HGO93_RS13865 (HGO93_10580) groES 2810625..2810909 (+) 285 WP_000917289.1 co-chaperone GroES -
  HGO93_RS13870 (HGO93_10575) groL 2810985..2812601 (+) 1617 WP_000240642.1 chaperonin GroEL -
  HGO93_RS13875 (HGO93_10570) - 2812696..2813242 (-) 547 Protein_2697 site-specific integrase -
  HGO93_RS13880 (HGO93_10565) - 2813303..2813515 (+) 213 WP_000128898.1 hypothetical protein -
  HGO93_RS13885 (HGO93_10560) - 2813512..2814102 (+) 591 WP_001293059.1 terminase small subunit -
  HGO93_RS13890 (HGO93_10555) - 2814419..2814856 (+) 438 WP_072419900.1 hypothetical protein -
  HGO93_RS13895 (HGO93_10550) - 2814962..2815405 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  HGO93_RS13900 (HGO93_10545) - 2816259..2817566 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  HGO93_RS13905 (HGO93_10540) - 2817727..2818638 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  HGO93_RS13910 (HGO93_10535) - 2818700..2819545 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  HGO93_RS13915 (HGO93_10530) - 2819917..2821140 (-) 1224 WP_000206623.1 ArgE/DapE family deacylase -
  HGO93_RS13920 (HGO93_10525) lukH 2821576..2822628 (+) 1053 WP_000791417.1 bi-component leukocidin LukGH subunit H -
  HGO93_RS13925 (HGO93_10520) lukG 2822650..2823666 (+) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  HGO93_RS13930 (HGO93_10515) sph 2823904..2824734 (-) 831 Protein_2708 sphingomyelin phosphodiesterase -
  HGO93_RS13935 (HGO93_10510) - 2824785..2825822 (-) 1038 WP_000857176.1 site-specific integrase -
  HGO93_RS13940 (HGO93_10505) - 2825930..2826544 (+) 615 WP_000191459.1 hypothetical protein -
  HGO93_RS13945 (HGO93_10500) - 2826541..2826687 (-) 147 WP_001013104.1 hypothetical protein -
  HGO93_RS13950 (HGO93_10495) - 2826723..2826905 (-) 183 WP_000705248.1 hypothetical protein -
  HGO93_RS13955 (HGO93_10490) - 2827135..2827719 (-) 585 WP_249741482.1 gas vesicle protein GvpG -
  HGO93_RS13960 (HGO93_10485) - 2827737..2828456 (-) 720 WP_249741483.1 XRE family transcriptional regulator -
  HGO93_RS13965 (HGO93_10480) - 2828599..2828817 (+) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  HGO93_RS13970 (HGO93_10475) - 2828831..2829091 (+) 261 WP_249741484.1 transcriptional regulator -
  HGO93_RS13975 (HGO93_10470) - 2829115..2829654 (-) 540 WP_000351243.1 hypothetical protein -
  HGO93_RS13980 (HGO93_10465) - 2829711..2830463 (+) 753 WP_249741485.1 phage antirepressor KilAC domain-containing protein -
  HGO93_RS13985 (HGO93_10460) - 2830479..2830673 (+) 195 WP_001566738.1 hypothetical protein -
  HGO93_RS13990 (HGO93_10455) - 2830668..2831024 (-) 357 WP_000768245.1 DUF2513 domain-containing protein -
  HGO93_RS13995 (HGO93_10450) - 2831074..2831265 (+) 192 WP_000389905.1 hypothetical protein -
  HGO93_RS14000 (HGO93_10445) - 2831267..2831494 (-) 228 WP_000801108.1 hypothetical protein -
  HGO93_RS14005 (HGO93_10440) - 2831553..2831873 (+) 321 WP_001120935.1 DUF771 domain-containing protein -
  HGO93_RS14010 (HGO93_10435) - 2831870..2832028 (+) 159 WP_249741396.1 DUF1270 family protein -
  HGO93_RS14015 (HGO93_10430) - 2832125..2832427 (+) 303 WP_044131919.1 DUF2482 family protein -
  HGO93_RS14020 (HGO93_10425) - 2832432..2832692 (+) 261 WP_031763794.1 DUF1108 family protein -
  HGO93_RS14025 (HGO93_10420) - 2832701..2832964 (+) 264 WP_001205732.1 hypothetical protein -
  HGO93_RS14030 (HGO93_10415) - 2832961..2834916 (+) 1956 WP_048657537.1 AAA family ATPase -
  HGO93_RS14035 (HGO93_10410) - 2834918..2835838 (+) 921 WP_000138479.1 recombinase RecT -
  HGO93_RS14040 (HGO93_10405) - 2835919..2836536 (+) 618 WP_249741440.1 MBL fold metallo-hydrolase -
  HGO93_RS14045 (HGO93_10400) ssbA 2836537..2837007 (+) 471 WP_138076570.1 single-stranded DNA-binding protein Machinery gene
  HGO93_RS14050 (HGO93_10395) - 2837037..2837921 (+) 885 WP_047213628.1 DnaD domain protein -
  HGO93_RS14055 (HGO93_10390) - 2837928..2838146 (+) 219 WP_000338528.1 hypothetical protein -
  HGO93_RS14060 (HGO93_10385) - 2838155..2838559 (+) 405 WP_249741397.1 RusA family crossover junction endodeoxyribonuclease -
  HGO93_RS14065 (HGO93_10380) - 2838572..2838940 (+) 369 WP_249741486.1 SA1788 family PVL leukocidin-associated protein -
  HGO93_RS14070 (HGO93_10375) - 2838944..2839186 (+) 243 WP_000131381.1 phi PVL orf 51-like protein -
  HGO93_RS14075 (HGO93_10370) - 2839201..2839449 (+) 249 WP_249741539.1 DUF1024 family protein -
  HGO93_RS14080 (HGO93_10365) - 2839442..2839954 (+) 513 WP_249741487.1 dUTP pyrophosphatase -
  HGO93_RS14085 (HGO93_10360) - 2840024..2840197 (+) 174 WP_249741488.1 hypothetical protein -
  HGO93_RS14090 (HGO93_10355) - 2840194..2840400 (+) 207 WP_249741489.1 DUF1381 domain-containing protein -
  HGO93_RS14095 (HGO93_10350) - 2840397..2840546 (+) 150 WP_249741490.1 transcriptional activator RinB -
  HGO93_RS14100 (HGO93_10345) - 2840546..2840746 (+) 201 WP_000265041.1 DUF1514 family protein -
  HGO93_RS14105 (HGO93_10340) - 2840769..2841230 (+) 462 WP_000282753.1 hypothetical protein -
  HGO93_RS14110 (HGO93_10335) - 2841345..2841797 (+) 453 WP_249741491.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  HGO93_RS14115 (HGO93_10330) - 2841813..2842157 (+) 345 WP_111061145.1 HNH endonuclease -
  HGO93_RS14120 (HGO93_10325) - 2842287..2842754 (+) 468 WP_000919026.1 phage terminase small subunit P27 family -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17653.57 Da        Isoelectric Point: 5.2672

>NTDB_id=438851 HGO93_RS14045 WP_138076570.1 2836537..2837007(+) (ssbA) [Staphylococcus aureus strain NGA104a]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVFVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=438851 HGO93_RS14045 WP_138076570.1 2836537..2837007(+) (ssbA) [Staphylococcus aureus strain NGA104a]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTCGATGGCAGATTACAAACGCGT
AATTATGAAAATAAGGAAGGTCAACGTGTGTTTGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

67.949

0.397