Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HC660_RS15985 Genome accession   NZ_CP051464
Coordinates   3043877..3044017 (-) Length   46 a.a.
NCBI ID   WP_010331694.1    Uniprot ID   A0AAP3CUJ5
Organism   Bacillus mojavensis strain UCMB5075     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3038877..3049017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC660_RS15960 (HC660_30540) - 3039186..3039566 (-) 381 WP_106022011.1 hotdog fold thioesterase -
  HC660_RS15965 (HC660_30550) comA 3039584..3040228 (-) 645 WP_168748642.1 two-component system response regulator ComA Regulator
  HC660_RS15970 comP 3040309..3042623 (-) 2315 Protein_3098 two-component system sensor histidine kinase ComP -
  HC660_RS15975 (HC660_30570) comX 3042639..3042806 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  HC660_RS15980 (HC660_30580) comQ 3042790..3043692 (-) 903 WP_168749496.1 polyprenyl synthetase family protein Regulator
  HC660_RS15985 (HC660_30590) degQ 3043877..3044017 (-) 141 WP_010331694.1 degradation enzyme regulation protein DegQ Regulator
  HC660_RS15990 - 3044478..3044846 (+) 369 WP_010331695.1 hypothetical protein -
  HC660_RS15995 (HC660_30600) - 3044822..3046051 (-) 1230 WP_168748643.1 EAL and HDOD domain-containing protein -
  HC660_RS16000 (HC660_30610) - 3046187..3047656 (-) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  HC660_RS16005 (HC660_30620) - 3047672..3048223 (-) 552 WP_168748644.1 isochorismatase family cysteine hydrolase -
  HC660_RS16010 (HC660_30630) - 3048320..3048718 (-) 399 WP_168748645.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5517.44 Da        Isoelectric Point: 6.2565

>NTDB_id=438511 HC660_RS15985 WP_010331694.1 3043877..3044017(-) (degQ) [Bacillus mojavensis strain UCMB5075]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=438511 HC660_RS15985 WP_010331694.1 3043877..3044017(-) (degQ) [Bacillus mojavensis strain UCMB5075]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957