Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   HC661_RS11865 Genome accession   NZ_CP051463
Coordinates   2461249..2461422 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UCMB5140     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2456249..2466422
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HC661_RS11850 (HC661_22700) gcvT 2457062..2458162 (-) 1101 WP_015417809.1 glycine cleavage system aminomethyltransferase GcvT -
  HC661_RS11855 (HC661_22710) - 2458586..2460256 (+) 1671 WP_015417810.1 SNF2-related protein -
  HC661_RS11860 (HC661_22720) - 2460278..2461072 (+) 795 WP_015417811.1 YqhG family protein -
  HC661_RS11865 (HC661_22730) sinI 2461249..2461422 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  HC661_RS11870 (HC661_22740) sinR 2461456..2461791 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HC661_RS11875 (HC661_22750) - 2461839..2462624 (-) 786 WP_007408329.1 TasA family protein -
  HC661_RS11880 (HC661_22760) - 2462689..2463273 (-) 585 WP_015240205.1 signal peptidase I -
  HC661_RS11885 (HC661_22770) tapA 2463245..2463916 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  HC661_RS11890 (HC661_22780) - 2464175..2464504 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HC661_RS11895 (HC661_22790) - 2464544..2464723 (-) 180 WP_003153093.1 YqzE family protein -
  HC661_RS11900 (HC661_22800) comGG 2464780..2465157 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  HC661_RS11905 (HC661_22810) comGF 2465158..2465658 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  HC661_RS11910 (HC661_22820) comGE 2465567..2465881 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  HC661_RS11915 (HC661_22830) comGD 2465865..2466302 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=438412 HC661_RS11865 WP_003153105.1 2461249..2461422(+) (sinI) [Bacillus velezensis strain UCMB5140]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=438412 HC661_RS11865 WP_003153105.1 2461249..2461422(+) (sinI) [Bacillus velezensis strain UCMB5140]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702