Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HC661_RS11865 | Genome accession | NZ_CP051463 |
| Coordinates | 2461249..2461422 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain UCMB5140 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2456249..2466422
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HC661_RS11850 (HC661_22700) | gcvT | 2457062..2458162 (-) | 1101 | WP_015417809.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HC661_RS11855 (HC661_22710) | - | 2458586..2460256 (+) | 1671 | WP_015417810.1 | SNF2-related protein | - |
| HC661_RS11860 (HC661_22720) | - | 2460278..2461072 (+) | 795 | WP_015417811.1 | YqhG family protein | - |
| HC661_RS11865 (HC661_22730) | sinI | 2461249..2461422 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| HC661_RS11870 (HC661_22740) | sinR | 2461456..2461791 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HC661_RS11875 (HC661_22750) | - | 2461839..2462624 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| HC661_RS11880 (HC661_22760) | - | 2462689..2463273 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| HC661_RS11885 (HC661_22770) | tapA | 2463245..2463916 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HC661_RS11890 (HC661_22780) | - | 2464175..2464504 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| HC661_RS11895 (HC661_22790) | - | 2464544..2464723 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| HC661_RS11900 (HC661_22800) | comGG | 2464780..2465157 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HC661_RS11905 (HC661_22810) | comGF | 2465158..2465658 (-) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| HC661_RS11910 (HC661_22820) | comGE | 2465567..2465881 (-) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| HC661_RS11915 (HC661_22830) | comGD | 2465865..2466302 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=438412 HC661_RS11865 WP_003153105.1 2461249..2461422(+) (sinI) [Bacillus velezensis strain UCMB5140]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=438412 HC661_RS11865 WP_003153105.1 2461249..2461422(+) (sinI) [Bacillus velezensis strain UCMB5140]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |