Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | IMZ18_RS05815 | Genome accession | NZ_CP063151 |
| Coordinates | 1084171..1084344 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis strain CMIN-4 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1079171..1089344
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IMZ18_RS05770 (IMZ18_05770) | comGE | 1079522..1079869 (+) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
| IMZ18_RS05775 (IMZ18_05775) | comGF | 1079895..1080278 (+) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| IMZ18_RS05780 (IMZ18_05780) | comGG | 1080279..1080653 (+) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| IMZ18_RS05785 (IMZ18_05785) | spoIITA | 1080724..1080903 (+) | 180 | WP_014480252.1 | YqzE family protein | - |
| IMZ18_RS05790 (IMZ18_05790) | yqzG | 1080945..1081271 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| IMZ18_RS05795 (IMZ18_05795) | tapA | 1081543..1082304 (+) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| IMZ18_RS05800 (IMZ18_05800) | sipW | 1082288..1082860 (+) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| IMZ18_RS05805 (IMZ18_05805) | tasA | 1082924..1083709 (+) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| IMZ18_RS05810 (IMZ18_05810) | sinR | 1083802..1084137 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| IMZ18_RS05815 (IMZ18_05815) | sinI | 1084171..1084344 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| IMZ18_RS05820 (IMZ18_05820) | yqhG | 1084527..1085321 (-) | 795 | WP_014480249.1 | YqhG family protein | - |
| IMZ18_RS05825 (IMZ18_05825) | hepAA | 1085342..1087015 (-) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| IMZ18_RS05830 (IMZ18_05830) | gcvT | 1087457..1088545 (+) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=437219 IMZ18_RS05815 WP_003230187.1 1084171..1084344(-) (sinI) [Bacillus subtilis subsp. subtilis strain CMIN-4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=437219 IMZ18_RS05815 WP_003230187.1 1084171..1084344(-) (sinI) [Bacillus subtilis subsp. subtilis strain CMIN-4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |