Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   IMZ18_RS05780 Genome accession   NZ_CP063151
Coordinates   1080279..1080653 (+) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain CMIN-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1075279..1085653
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMZ18_RS05740 (IMZ18_05740) corA 1075349..1076302 (+) 954 WP_014480260.1 magnesium transporter CorA -
  IMZ18_RS05745 (IMZ18_05745) - 1076304..1076501 (+) 198 WP_014480259.1 CBS domain-containing protein -
  IMZ18_RS05750 (IMZ18_05750) comGA 1076713..1077783 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  IMZ18_RS05755 (IMZ18_05755) comGB 1077770..1078807 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  IMZ18_RS05760 (IMZ18_05760) comGC 1078821..1079117 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  IMZ18_RS05765 (IMZ18_05765) comGD 1079107..1079538 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  IMZ18_RS05770 (IMZ18_05770) comGE 1079522..1079869 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  IMZ18_RS05775 (IMZ18_05775) comGF 1079895..1080278 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  IMZ18_RS05780 (IMZ18_05780) comGG 1080279..1080653 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  IMZ18_RS05785 (IMZ18_05785) spoIITA 1080724..1080903 (+) 180 WP_014480252.1 YqzE family protein -
  IMZ18_RS05790 (IMZ18_05790) yqzG 1080945..1081271 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  IMZ18_RS05795 (IMZ18_05795) tapA 1081543..1082304 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  IMZ18_RS05800 (IMZ18_05800) sipW 1082288..1082860 (+) 573 WP_003230181.1 signal peptidase I SipW -
  IMZ18_RS05805 (IMZ18_05805) tasA 1082924..1083709 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  IMZ18_RS05810 (IMZ18_05810) sinR 1083802..1084137 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  IMZ18_RS05815 (IMZ18_05815) sinI 1084171..1084344 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  IMZ18_RS05820 (IMZ18_05820) yqhG 1084527..1085321 (-) 795 WP_014480249.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=437217 IMZ18_RS05780 WP_014480253.1 1080279..1080653(+) (comGG) [Bacillus subtilis subsp. subtilis strain CMIN-4]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=437217 IMZ18_RS05780 WP_014480253.1 1080279..1080653(+) (comGG) [Bacillus subtilis subsp. subtilis strain CMIN-4]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976