Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HEQ83_RS11645 Genome accession   NZ_CP051011
Coordinates   2434504..2434881 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain BY6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2429504..2439881
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HEQ83_RS11605 - 2430003..2430797 (+) 795 WP_069473503.1 YqhG family protein -
  HEQ83_RS11610 sinI 2430974..2431147 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HEQ83_RS11615 sinR 2431181..2431516 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HEQ83_RS11620 tasA 2431564..2432349 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  HEQ83_RS11625 sipW 2432413..2432997 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HEQ83_RS11630 tapA 2432969..2433640 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  HEQ83_RS11635 - 2433899..2434228 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HEQ83_RS11640 - 2434268..2434447 (-) 180 WP_003153093.1 YqzE family protein -
  HEQ83_RS11645 comGG 2434504..2434881 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HEQ83_RS11650 comGF 2434882..2435277 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  HEQ83_RS11655 comGE 2435291..2435605 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  HEQ83_RS11660 comGD 2435589..2436026 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  HEQ83_RS11665 comGC 2436016..2436324 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HEQ83_RS11670 comGB 2436329..2437366 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  HEQ83_RS11675 comGA 2437353..2438423 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HEQ83_RS11680 - 2438615..2439565 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=436012 HEQ83_RS11645 WP_003153092.1 2434504..2434881(-) (comGG) [Bacillus velezensis strain BY6]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=436012 HEQ83_RS11645 WP_003153092.1 2434504..2434881(-) (comGG) [Bacillus velezensis strain BY6]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512