Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HEQ83_RS11610 Genome accession   NZ_CP051011
Coordinates   2430974..2431147 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain BY6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2425974..2436147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HEQ83_RS11595 gcvT 2426792..2427892 (-) 1101 WP_069473502.1 glycine cleavage system aminomethyltransferase GcvT -
  HEQ83_RS11600 - 2428315..2429985 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  HEQ83_RS11605 - 2430003..2430797 (+) 795 WP_069473503.1 YqhG family protein -
  HEQ83_RS11610 sinI 2430974..2431147 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HEQ83_RS11615 sinR 2431181..2431516 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HEQ83_RS11620 tasA 2431564..2432349 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  HEQ83_RS11625 sipW 2432413..2432997 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HEQ83_RS11630 tapA 2432969..2433640 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  HEQ83_RS11635 - 2433899..2434228 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HEQ83_RS11640 - 2434268..2434447 (-) 180 WP_003153093.1 YqzE family protein -
  HEQ83_RS11645 comGG 2434504..2434881 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HEQ83_RS11650 comGF 2434882..2435277 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  HEQ83_RS11655 comGE 2435291..2435605 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  HEQ83_RS11660 comGD 2435589..2436026 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=436010 HEQ83_RS11610 WP_003153105.1 2430974..2431147(+) (sinI) [Bacillus velezensis strain BY6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=436010 HEQ83_RS11610 WP_003153105.1 2430974..2431147(+) (sinI) [Bacillus velezensis strain BY6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702