Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   HCN55_RS13295 Genome accession   NZ_CP050532
Coordinates   2549439..2549813 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis str. SMY     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2544439..2554813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCN55_RS13255 (HCN55_13260) yqhG 2544771..2545565 (+) 795 WP_003230200.1 YqhG family protein -
  HCN55_RS13260 (HCN55_13265) sinI 2545748..2545921 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HCN55_RS13265 (HCN55_13270) sinR 2545955..2546290 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HCN55_RS13270 (HCN55_13275) tasA 2546383..2547168 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  HCN55_RS13275 (HCN55_13280) sipW 2547232..2547804 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HCN55_RS13280 (HCN55_13285) tapA 2547788..2548549 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HCN55_RS13285 (HCN55_13290) yqzG 2548821..2549147 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HCN55_RS13290 (HCN55_13295) spoIITA 2549189..2549368 (-) 180 WP_003230176.1 YqzE family protein -
  HCN55_RS13295 (HCN55_13300) comGG 2549439..2549813 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HCN55_RS13300 (HCN55_13305) comGF 2549814..2550197 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  HCN55_RS13305 (HCN55_13310) comGE 2550223..2550570 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  HCN55_RS13310 (HCN55_13315) comGD 2550554..2550985 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  HCN55_RS13315 (HCN55_13320) comGC 2550975..2551271 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  HCN55_RS13320 (HCN55_13325) comGB 2551285..2552322 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  HCN55_RS13325 (HCN55_13330) comGA 2552309..2553379 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  HCN55_RS13330 (HCN55_13335) corA 2553791..2554744 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=433746 HCN55_RS13295 WP_003230170.1 2549439..2549813(-) (comGG) [Bacillus subtilis subsp. subtilis str. SMY]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=433746 HCN55_RS13295 WP_003230170.1 2549439..2549813(-) (comGG) [Bacillus subtilis subsp. subtilis str. SMY]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1