Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HCN55_RS13260 Genome accession   NZ_CP050532
Coordinates   2545748..2545921 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. SMY     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2540748..2550921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCN55_RS13245 (HCN55_13250) gcvT 2541547..2542635 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  HCN55_RS13250 (HCN55_13255) hepAA 2543077..2544750 (+) 1674 WP_004398544.1 SNF2-related protein -
  HCN55_RS13255 (HCN55_13260) yqhG 2544771..2545565 (+) 795 WP_003230200.1 YqhG family protein -
  HCN55_RS13260 (HCN55_13265) sinI 2545748..2545921 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  HCN55_RS13265 (HCN55_13270) sinR 2545955..2546290 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  HCN55_RS13270 (HCN55_13275) tasA 2546383..2547168 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  HCN55_RS13275 (HCN55_13280) sipW 2547232..2547804 (-) 573 WP_003246088.1 signal peptidase I SipW -
  HCN55_RS13280 (HCN55_13285) tapA 2547788..2548549 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  HCN55_RS13285 (HCN55_13290) yqzG 2548821..2549147 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  HCN55_RS13290 (HCN55_13295) spoIITA 2549189..2549368 (-) 180 WP_003230176.1 YqzE family protein -
  HCN55_RS13295 (HCN55_13300) comGG 2549439..2549813 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  HCN55_RS13300 (HCN55_13305) comGF 2549814..2550197 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  HCN55_RS13305 (HCN55_13310) comGE 2550223..2550570 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=433744 HCN55_RS13260 WP_003230187.1 2545748..2545921(+) (sinI) [Bacillus subtilis subsp. subtilis str. SMY]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=433744 HCN55_RS13260 WP_003230187.1 2545748..2545921(+) (sinI) [Bacillus subtilis subsp. subtilis str. SMY]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1