Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   HA248_RS02610 Genome accession   NZ_CP050175
Coordinates   503201..503350 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain PZ900701590     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 498201..508350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HA248_RS02580 (HA248_02575) blpC 498404..498559 (-) 156 WP_000358814.1 quorum-sensing system pheromone BlpC -
  HA248_RS02585 (HA248_02580) - 498616..499977 (-) 1362 WP_033705510.1 bacteriocin secretion accessory protein -
  HA248_RS02590 (HA248_02585) comA/nlmT 499988..501664 (-) 1677 WP_317830619.1 peptide cleavage/export ABC transporter Regulator
  HA248_RS11795 comA/nlmT 501558..502145 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  HA248_RS02600 (HA248_02590) blpM 502484..502738 (+) 255 WP_033705509.1 two-peptide bacteriocin subunit BlpM -
  HA248_RS02605 (HA248_02595) blpN 502754..502957 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  HA248_RS02610 (HA248_02600) cipB 503201..503350 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  HA248_RS02615 (HA248_02605) - 503454..503573 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  HA248_RS02620 (HA248_02610) - 504093..504412 (+) 320 Protein_513 immunity protein -
  HA248_RS02625 (HA248_02615) - 504573..505542 (+) 970 Protein_514 thioredoxin domain-containing protein -
  HA248_RS02630 (HA248_02620) - 505789..506022 (+) 234 WP_033705506.1 bacteriocin class II family protein -
  HA248_RS02635 (HA248_02625) - 506054..506743 (+) 690 WP_033705505.1 CPBP family intramembrane glutamic endopeptidase -
  HA248_RS02640 (HA248_02630) blpZ 506785..507033 (+) 249 WP_000276506.1 immunity protein BlpZ -
  HA248_RS02645 (HA248_02635) - 507063..507674 (+) 612 WP_000394042.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=430525 HA248_RS02610 WP_001809846.1 503201..503350(+) (cipB) [Streptococcus pneumoniae strain PZ900701590]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=430525 HA248_RS02610 WP_001809846.1 503201..503350(+) (cipB) [Streptococcus pneumoniae strain PZ900701590]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531