Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   G3T12_RS04970 Genome accession   NZ_CP048623
Coordinates   1039165..1039650 (+) Length   161 a.a.
NCBI ID   WP_064535069.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain WHH1155     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1027986..1068255 1039165..1039650 within 0


Gene organization within MGE regions


Location: 1027986..1068255
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  G3T12_RS04865 (G3T12_04975) - 1027986..1029170 (-) 1185 Protein_928 tyrosine-type recombinase/integrase -
  G3T12_RS04870 (G3T12_04980) - 1029317..1029547 (+) 231 WP_223804796.1 hypothetical protein -
  G3T12_RS04875 (G3T12_04985) - 1029515..1030516 (-) 1002 WP_394535228.1 hypothetical protein -
  G3T12_RS04880 (G3T12_04990) - 1030627..1030830 (-) 204 WP_064535051.1 hypothetical protein -
  G3T12_RS04885 (G3T12_04995) - 1030854..1031279 (-) 426 WP_064535053.1 pyridoxamine 5'-phosphate oxidase family protein -
  G3T12_RS04890 (G3T12_05000) - 1031665..1031883 (+) 219 WP_016364974.1 hypothetical protein -
  G3T12_RS04895 (G3T12_05005) - 1031884..1032639 (-) 756 WP_003606998.1 hypothetical protein -
  G3T12_RS04900 (G3T12_05010) - 1032746..1033447 (-) 702 WP_064535055.1 DUF3862 domain-containing protein -
  G3T12_RS04905 (G3T12_05015) - 1033507..1033929 (-) 423 WP_064535057.1 ImmA/IrrE family metallo-endopeptidase -
  G3T12_RS04910 (G3T12_05020) - 1033919..1034254 (-) 336 WP_005714743.1 helix-turn-helix domain-containing protein -
  G3T12_RS04915 (G3T12_05025) - 1034392..1034634 (+) 243 WP_064535059.1 helix-turn-helix transcriptional regulator -
  G3T12_RS04920 (G3T12_05030) - 1034721..1034906 (-) 186 WP_003580689.1 DUF1508 domain-containing protein -
  G3T12_RS04925 - 1034994..1035152 (+) 159 WP_191981448.1 hypothetical protein -
  G3T12_RS04930 (G3T12_05035) - 1035218..1035766 (+) 549 WP_003582311.1 hypothetical protein -
  G3T12_RS04935 (G3T12_05040) - 1035745..1035975 (+) 231 WP_005711341.1 hypothetical protein -
  G3T12_RS04940 - 1035979..1036107 (+) 129 WP_005711343.1 hypothetical protein -
  G3T12_RS04945 (G3T12_05045) - 1036119..1036337 (+) 219 WP_064535061.1 hypothetical protein -
  G3T12_RS04950 - 1036339..1036509 (+) 171 WP_168163030.1 hypothetical protein -
  G3T12_RS04955 (G3T12_05050) - 1036521..1037396 (+) 876 WP_064535063.1 recombinase RecT -
  G3T12_RS04960 (G3T12_05055) - 1037416..1038180 (+) 765 WP_064535065.1 PD-(D/E)XK nuclease-like domain-containing protein -
  G3T12_RS04965 (G3T12_05060) - 1038196..1039152 (+) 957 WP_064535067.1 DnaD domain-containing protein -
  G3T12_RS04970 (G3T12_05065) ssb 1039165..1039650 (+) 486 WP_064535069.1 single-stranded DNA-binding protein Machinery gene
  G3T12_RS04975 (G3T12_05070) - 1039959..1040174 (+) 216 WP_015764329.1 helix-turn-helix transcriptional regulator -
  G3T12_RS04980 (G3T12_05075) - 1040171..1040620 (+) 450 WP_064535071.1 hypothetical protein -
  G3T12_RS04985 (G3T12_05080) - 1040623..1041006 (+) 384 WP_064535073.1 DUF1064 domain-containing protein -
  G3T12_RS04990 - 1041018..1041143 (+) 126 WP_394535233.1 hypothetical protein -
  G3T12_RS04995 (G3T12_05085) - 1041140..1041349 (+) 210 WP_064535075.1 hypothetical protein -
  G3T12_RS05000 (G3T12_05090) - 1041421..1041732 (+) 312 WP_064535077.1 hypothetical protein -
  G3T12_RS05005 (G3T12_05095) - 1041722..1042078 (+) 357 WP_064535079.1 hypothetical protein -
  G3T12_RS05010 (G3T12_05100) - 1042075..1042314 (+) 240 WP_014569479.1 hypothetical protein -
  G3T12_RS05015 (G3T12_05105) - 1042728..1043156 (+) 429 WP_064535081.1 hypothetical protein -
  G3T12_RS05020 (G3T12_05110) - 1043579..1044151 (+) 573 WP_064535084.1 hypothetical protein -
  G3T12_RS05025 (G3T12_05115) - 1044782..1045999 (+) 1218 WP_064535086.1 GcrA family cell cycle regulator -
  G3T12_RS05030 (G3T12_05120) - 1045986..1046564 (+) 579 WP_064535088.1 NUMOD4 domain-containing protein -
  G3T12_RS05035 (G3T12_05125) - 1046557..1046877 (+) 321 WP_064535090.1 hypothetical protein -
  G3T12_RS05040 (G3T12_05130) - 1046914..1047486 (+) 573 WP_064535092.1 terminase small subunit -
  G3T12_RS05045 (G3T12_05135) - 1047470..1048723 (+) 1254 WP_064535094.1 PBSX family phage terminase large subunit -
  G3T12_RS05050 (G3T12_05140) - 1048728..1050155 (+) 1428 WP_064535096.1 phage portal protein -
  G3T12_RS05055 (G3T12_05145) - 1050121..1051113 (+) 993 WP_064535098.1 minor capsid protein -
  G3T12_RS05060 (G3T12_05150) - 1051238..1051894 (+) 657 WP_064535100.1 DUF4355 domain-containing protein -
  G3T12_RS05065 (G3T12_05155) - 1051910..1052923 (+) 1014 WP_064535102.1 hypothetical protein -
  G3T12_RS05070 (G3T12_05160) - 1053151..1053525 (+) 375 WP_064535103.1 phage head-tail connector protein -
  G3T12_RS05075 (G3T12_05165) - 1053530..1053832 (+) 303 WP_064535105.1 hypothetical protein -
  G3T12_RS05080 (G3T12_05170) - 1053829..1054194 (+) 366 WP_003575581.1 hypothetical protein -
  G3T12_RS05085 (G3T12_05175) - 1054195..1054599 (+) 405 WP_064535106.1 DUF3168 domain-containing protein -
  G3T12_RS05090 (G3T12_05180) - 1054611..1055210 (+) 600 WP_064535109.1 phage tail tube protein -
  G3T12_RS05095 (G3T12_05185) - 1055297..1055629 (+) 333 WP_064535111.1 tail assembly chaperone -
  G3T12_RS05100 (G3T12_05190) - 1055734..1056087 (+) 354 WP_064535124.1 hypothetical protein -
  G3T12_RS05105 (G3T12_05195) - 1056080..1059169 (+) 3090 WP_064535113.1 tape measure protein -
  G3T12_RS05110 (G3T12_05200) - 1059170..1061215 (+) 2046 WP_064535115.1 distal tail protein Dit -
  G3T12_RS05115 (G3T12_05205) - 1061216..1063750 (+) 2535 WP_394535238.1 phage tail protein -
  G3T12_RS05120 (G3T12_05210) - 1063760..1064050 (+) 291 WP_394535239.1 hypothetical protein -
  G3T12_RS05125 (G3T12_05215) - 1064043..1064174 (+) 132 WP_003573798.1 XkdX family protein -
  G3T12_RS05130 (G3T12_05220) - 1064204..1064494 (+) 291 WP_025013871.1 hypothetical protein -
  G3T12_RS05135 (G3T12_05225) - 1064487..1064933 (+) 447 WP_064535119.1 phage holin -
  G3T12_RS05140 (G3T12_05230) - 1064944..1066242 (+) 1299 WP_064535122.1 LysM peptidoglycan-binding domain-containing protein -
  G3T12_RS05145 - 1066441..1066515 (+) 75 Protein_984 glucose-6-phosphate isomerase -
  G3T12_RS05150 (G3T12_05235) - 1066822..1067109 (-) 288 WP_047676081.1 putative quinol monooxygenase -
  G3T12_RS05155 (G3T12_05240) - 1067404..1068255 (-) 852 WP_047676079.1 DNA/RNA non-specific endonuclease -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 17662.44 Da        Isoelectric Point: 8.9824

>NTDB_id=421906 G3T12_RS04970 WP_064535069.1 1039165..1039650(+) (ssb) [Lacticaseibacillus rhamnosus strain WHH1155]
MLNSVSLTGRMTRDVDLRYTQSGTAAGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFAKFTKKGSLVGVEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASATATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=421906 G3T12_RS04970 WP_064535069.1 1039165..1039650(+) (ssb) [Lacticaseibacillus rhamnosus strain WHH1155]
TTGCTAAACAGTGTCTCACTAACAGGCCGGATGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGCGGCAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGAGAAACTGATTTCGTAAATTGCCAGATTT
GGCGCAAGTCGGCTGAGAACTTTGCAAAATTCACCAAAAAAGGATCCTTGGTTGGTGTGGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAACAGCGACCACAAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

62.209

100

0.665

  ssbA Bacillus subtilis subsp. subtilis str. 168

48.837

100

0.522

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

65.839

0.36


Multiple sequence alignment