Detailed information    

insolico Bioinformatically predicted

Overview


Name   comP   Type   Machinery gene
Locus tag   GYN05_RS05810 Genome accession   NZ_CP048250
Coordinates   1100469..1100918 (-) Length   149 a.a.
NCBI ID   WP_002214937.1    Uniprot ID   A0AA44U8B7
Organism   Neisseria gonorrhoeae strain CT532     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1054581..1127343 1100469..1100918 within 0


Gene organization within MGE regions


Location: 1054581..1127343
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GYN05_RS05490 (GYN05_05340) - 1054581..1055426 (+) 846 WP_003690940.1 BRO family protein -
  GYN05_RS05495 (GYN05_05345) - 1055612..1056286 (-) 675 WP_003687998.1 hypothetical protein -
  GYN05_RS05500 (GYN05_05350) - 1056283..1056768 (-) 486 WP_003687997.1 hypothetical protein -
  GYN05_RS05505 (GYN05_05355) - 1056774..1057247 (-) 474 WP_003690936.1 hypothetical protein -
  GYN05_RS05510 (GYN05_05360) - 1057302..1058597 (-) 1296 WP_003690933.1 DUF4043 family protein -
  GYN05_RS05515 (GYN05_05370) - 1059223..1066521 (-) 7299 WP_250328996.1 PLxRFG domain-containing protein -
  GYN05_RS05520 (GYN05_05375) - 1066518..1067714 (-) 1197 WP_197098001.1 hypothetical protein -
  GYN05_RS05525 - 1067951..1068343 (-) 393 WP_229690718.1 hypothetical protein -
  GYN05_RS05530 (GYN05_05380) - 1068359..1070218 (-) 1860 WP_231592927.1 hypothetical protein -
  GYN05_RS05535 (GYN05_05385) - 1070203..1071477 (-) 1275 WP_337999659.1 PBSX family phage terminase large subunit -
  GYN05_RS05540 - 1071458..1071997 (-) 540 WP_003690920.1 hypothetical protein -
  GYN05_RS05545 (GYN05_05400) - 1071997..1072419 (-) 423 WP_003690919.1 hypothetical protein -
  GYN05_RS05550 (GYN05_05405) - 1072484..1073002 (-) 519 WP_003693459.1 HNH endonuclease -
  GYN05_RS05555 (GYN05_05410) - 1072993..1073376 (-) 384 WP_003690918.1 recombination protein NinB -
  GYN05_RS05560 (GYN05_05415) - 1073373..1073678 (-) 306 WP_003687981.1 nuclease domain-containing protein -
  GYN05_RS05565 (GYN05_05420) - 1073671..1074108 (-) 438 WP_017147288.1 RusA family crossover junction endodeoxyribonuclease -
  GYN05_RS05570 - 1074099..1074380 (-) 282 WP_003689109.1 hypothetical protein -
  GYN05_RS05575 - 1074409..1074558 (-) 150 WP_003689110.1 hypothetical protein -
  GYN05_RS05580 (GYN05_05425) - 1074735..1075229 (-) 495 WP_041421248.1 DUF3310 domain-containing protein -
  GYN05_RS05585 (GYN05_05430) - 1075268..1075474 (-) 207 WP_154235857.1 hypothetical protein -
  GYN05_RS05590 (GYN05_05435) - 1075544..1076326 (-) 783 WP_025456432.1 ATP-binding protein -
  GYN05_RS05595 (GYN05_05440) - 1076342..1077382 (-) 1041 WP_250328954.1 helix-turn-helix domain-containing protein -
  GYN05_RS05600 (GYN05_05445) - 1077379..1077606 (-) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  GYN05_RS05605 (GYN05_05450) - 1077779..1077967 (+) 189 WP_003706568.1 hypothetical protein -
  GYN05_RS05610 - 1077944..1078099 (-) 156 WP_003691446.1 hypothetical protein -
  GYN05_RS05615 (GYN05_05455) - 1078179..1078394 (-) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  GYN05_RS05620 (GYN05_05460) - 1078522..1079226 (+) 705 WP_050161651.1 helix-turn-helix transcriptional regulator -
  GYN05_RS05625 (GYN05_05465) - 1079386..1079925 (+) 540 WP_003695998.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  GYN05_RS05630 (GYN05_05470) - 1079926..1080285 (+) 360 WP_003691733.1 hypothetical protein -
  GYN05_RS05635 (GYN05_05475) - 1080301..1080519 (-) 219 WP_003691731.1 hypothetical protein -
  GYN05_RS05640 (GYN05_05480) - 1081003..1081203 (+) 201 WP_003704298.1 hypothetical protein -
  GYN05_RS05645 (GYN05_05485) - 1081236..1081712 (+) 477 WP_002255718.1 hypothetical protein -
  GYN05_RS05650 (GYN05_05490) - 1081709..1082002 (+) 294 WP_250328953.1 hypothetical protein -
  GYN05_RS05655 (GYN05_05495) - 1082143..1082475 (+) 333 WP_003705604.1 hypothetical protein -
  GYN05_RS05660 (GYN05_05500) - 1082628..1082903 (+) 276 WP_050154389.1 hypothetical protein -
  GYN05_RS05665 - 1082900..1083061 (+) 162 WP_003691530.1 hypothetical protein -
  GYN05_RS05670 (GYN05_05505) - 1083130..1083816 (+) 687 WP_003691532.1 hypothetical protein -
  GYN05_RS05675 (GYN05_05510) - 1083956..1084138 (+) 183 WP_003691535.1 hypothetical protein -
  GYN05_RS05680 (GYN05_05515) - 1084135..1084626 (+) 492 WP_218422917.1 siphovirus Gp157 family protein -
  GYN05_RS05685 (GYN05_05520) - 1084678..1084893 (+) 216 WP_003691538.1 hypothetical protein -
  GYN05_RS05690 (GYN05_05525) - 1085004..1085987 (+) 984 WP_047919222.1 hypothetical protein -
  GYN05_RS05695 (GYN05_05530) - 1085984..1086397 (+) 414 WP_010951196.1 hypothetical protein -
  GYN05_RS05700 (GYN05_05535) - 1086423..1086617 (+) 195 WP_003689159.1 hypothetical protein -
  GYN05_RS05710 (GYN05_05545) - 1086908..1087582 (+) 675 WP_003689160.1 hypothetical protein -
  GYN05_RS05715 (GYN05_05550) ribA 1087575..1088168 (+) 594 WP_003689161.1 GTP cyclohydrolase II -
  GYN05_RS05720 (GYN05_05555) - 1088336..1088518 (+) 183 Protein_1122 glycosyltransferase -
  GYN05_RS05725 (GYN05_05560) - 1088521..1089483 (+) 963 WP_250328937.1 IS110 family transposase -
  GYN05_RS05730 (GYN05_05565) - 1090117..1090476 (-) 360 WP_003689732.1 hypothetical protein -
  GYN05_RS05735 (GYN05_05570) - 1090597..1091669 (-) 1073 Protein_1125 zonular occludens toxin domain-containing protein -
  GYN05_RS05740 (GYN05_05575) - 1091679..1091969 (-) 291 WP_047917922.1 DUF2523 domain-containing protein -
  GYN05_RS05745 (GYN05_05580) - 1091948..1093537 (-) 1590 WP_202838264.1 IgG-binding virulence factor TspB family protein -
  GYN05_RS05750 (GYN05_05585) - 1093479..1093796 (-) 318 WP_003689167.1 DUF1132 family protein -
  GYN05_RS05755 (GYN05_05590) - 1093924..1094202 (-) 279 WP_003689168.1 hypothetical protein -
  GYN05_RS05760 (GYN05_05595) - 1094209..1094428 (-) 220 Protein_1130 major capsid protein -
  GYN05_RS05765 (GYN05_05600) - 1094502..1094699 (-) 198 WP_003689600.1 hypothetical protein -
  GYN05_RS05770 (GYN05_05605) - 1094704..1094994 (-) 291 WP_012503914.1 hypothetical protein -
  GYN05_RS05775 (GYN05_05610) - 1095039..1096390 (-) 1352 Protein_1133 replication initiation factor domain-containing protein -
  GYN05_RS05780 (GYN05_05615) - 1096528..1096950 (-) 423 WP_003691751.1 very short patch repair endonuclease -
  GYN05_RS05785 - 1096956..1097552 (-) 597 WP_012503916.1 TIGR02391 family protein -
  GYN05_RS05790 - 1097742..1098599 (-) 858 WP_012503917.1 ATP-binding protein -
  GYN05_RS05795 (GYN05_05625) - 1098613..1099047 (-) 435 WP_229684538.1 DNA cytosine methyltransferase -
  GYN05_RS05800 (GYN05_05630) - 1098981..1099571 (-) 591 WP_080229150.1 DNA cytosine methyltransferase -
  GYN05_RS05805 - 1099946..1100092 (+) 147 WP_003691757.1 hypothetical protein -
  GYN05_RS05810 (GYN05_05635) comP 1100469..1100918 (-) 450 WP_002214937.1 type IV pilin protein Machinery gene
  GYN05_RS05815 (GYN05_05640) comE 1101006..1101401 (-) 396 WP_003703428.1 helix-hairpin-helix domain-containing protein Machinery gene
  GYN05_RS05820 - 1101503..1101622 (-) 120 Protein_1142 competence protein ComE -
  GYN05_RS05850 (GYN05_05670) - 1107246..1107899 (-) 654 Protein_1143 TIGR01621 family pseudouridine synthase -
  GYN05_RS05855 (GYN05_05675) - 1107959..1108198 (-) 240 WP_229684458.1 HAD hydrolase family protein -
  GYN05_RS05860 - 1108490..1108651 (+) 162 WP_003698918.1 hypothetical protein -
  GYN05_RS05865 (GYN05_05685) - 1108671..1109324 (-) 654 WP_250328938.1 IS1595 family transposase -
  GYN05_RS05870 (GYN05_05690) - 1109416..1109754 (-) 339 WP_002218119.1 P-II family nitrogen regulator -
  GYN05_RS05875 (GYN05_05695) purL 1109905..1113861 (+) 3957 WP_250328939.1 phosphoribosylformylglycinamidine synthase -
  GYN05_RS05880 (GYN05_05700) - 1113932..1115143 (-) 1212 WP_003689615.1 NADH:flavin oxidoreductase/NADH oxidase family protein -
  GYN05_RS05885 (GYN05_05705) - 1115217..1115528 (-) 312 WP_003689616.1 metalloregulator ArsR/SmtB family transcription factor -
  GYN05_RS05890 (GYN05_05710) gloB 1115760..1116512 (+) 753 WP_003697499.1 hydroxyacylglutathione hydrolase -
  GYN05_RS05895 (GYN05_05715) mgtE 1116746..1118200 (+) 1455 WP_003696042.1 magnesium transporter -
  GYN05_RS05900 (GYN05_05720) hslO 1118286..1119194 (-) 909 WP_010360529.1 Hsp33 family molecular chaperone HslO -
  GYN05_RS05905 (GYN05_05725) - 1119439..1120020 (+) 582 WP_047920185.1 C40 family peptidase -
  GYN05_RS05910 (GYN05_05730) - 1120039..1120257 (+) 219 WP_003689624.1 hypothetical protein -
  GYN05_RS05915 (GYN05_05735) - 1120402..1120746 (+) 345 WP_002219918.1 CidA/LrgA family protein -
  GYN05_RS05920 (GYN05_05740) - 1120746..1121438 (+) 693 WP_003689629.1 LrgB family protein -
  GYN05_RS05925 (GYN05_05745) argJ 1121505..1122725 (+) 1221 WP_003689631.1 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ -
  GYN05_RS05930 (GYN05_05750) - 1122785..1124194 (+) 1410 WP_050161567.1 chloride channel protein -
  GYN05_RS05935 (GYN05_05755) hrpA 1124382..1125773 (+) 1392 WP_003689635.1 ATP-dependent RNA helicase HrpA -
  GYN05_RS05940 (GYN05_05760) - 1125841..1127343 (+) 1503 WP_025455914.1 SIR2 family protein -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16834.81 Da        Isoelectric Point: 9.7951

>NTDB_id=420193 GYN05_RS05810 WP_002214937.1 1100469..1100918(-) (comP) [Neisseria gonorrhoeae strain CT532]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide


Download         Length: 450 bp        

>NTDB_id=420193 GYN05_RS05810 WP_002214937.1 1100469..1100918(-) (comP) [Neisseria gonorrhoeae strain CT532]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria gonorrhoeae MS11

100

100

1

  comP Neisseria meningitidis 8013

99.329

100

0.993

  comP Neisseria subflava NJ9703

49.66

98.658

0.49


Multiple sequence alignment