Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   GWK37_RS11130 Genome accession   NZ_CP048002
Coordinates   2254734..2254853 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CACC 316     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2249734..2259853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWK37_RS11115 (GWK37_11120) - 2251347..2252030 (+) 684 WP_014416901.1 response regulator transcription factor -
  GWK37_RS11120 (GWK37_11125) - 2252017..2253444 (+) 1428 WP_115940437.1 sensor histidine kinase -
  GWK37_RS11125 (GWK37_11130) rapC 2253602..2254750 (+) 1149 WP_115940438.1 Rap family tetratricopeptide repeat protein Regulator
  GWK37_RS11130 (GWK37_11135) phrC 2254734..2254853 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  GWK37_RS11135 (GWK37_11140) - 2255005..2255115 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  GWK37_RS11140 (GWK37_11145) - 2255195..2256559 (-) 1365 WP_072177353.1 aspartate kinase -
  GWK37_RS11145 (GWK37_11150) ceuB 2256973..2257926 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  GWK37_RS11150 (GWK37_11155) - 2257916..2258863 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  GWK37_RS11155 (GWK37_11160) - 2258857..2259615 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=419243 GWK37_RS11130 WP_003156334.1 2254734..2254853(+) (phrC) [Bacillus velezensis strain CACC 316]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=419243 GWK37_RS11130 WP_003156334.1 2254734..2254853(+) (phrC) [Bacillus velezensis strain CACC 316]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment