Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   GWK37_RS01525 Genome accession   NZ_CP048002
Coordinates   315635..316072 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain CACC 316     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 310635..321072
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWK37_RS01475 (GWK37_01480) sinI 311018..311191 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  GWK37_RS01480 (GWK37_01485) sinR 311225..311560 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GWK37_RS01485 (GWK37_01490) tasA 311608..312393 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GWK37_RS01490 (GWK37_01495) sipW 312458..313042 (-) 585 WP_015240205.1 signal peptidase I SipW -
  GWK37_RS01495 (GWK37_01500) tapA 313014..313685 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  GWK37_RS01500 (GWK37_01505) - 313944..314273 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GWK37_RS01505 (GWK37_01510) - 314314..314493 (-) 180 WP_003153093.1 YqzE family protein -
  GWK37_RS01510 (GWK37_01515) comGG 314550..314927 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  GWK37_RS01515 (GWK37_01520) comGF 314928..315323 (-) 396 WP_115940643.1 competence type IV pilus minor pilin ComGF -
  GWK37_RS01520 (GWK37_01525) comGE 315337..315651 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  GWK37_RS01525 (GWK37_01530) comGD 315635..316072 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  GWK37_RS01530 (GWK37_01535) comGC 316062..316328 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  GWK37_RS01535 (GWK37_01540) comGB 316375..317412 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  GWK37_RS01540 (GWK37_01545) comGA 317399..318469 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  GWK37_RS01545 (GWK37_01550) - 318662..319612 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  GWK37_RS01550 (GWK37_01555) - 319758..321059 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=419202 GWK37_RS01525 WP_007612572.1 315635..316072(-) (comGD) [Bacillus velezensis strain CACC 316]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=419202 GWK37_RS01525 WP_007612572.1 315635..316072(-) (comGD) [Bacillus velezensis strain CACC 316]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment