Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GWK37_RS01475 Genome accession   NZ_CP048002
Coordinates   311018..311191 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain CACC 316     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 306018..316191
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GWK37_RS01460 (GWK37_01465) gcvT 306831..307931 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  GWK37_RS01465 (GWK37_01470) - 308355..310025 (+) 1671 WP_115940642.1 DEAD/DEAH box helicase -
  GWK37_RS01470 (GWK37_01475) - 310047..310841 (+) 795 WP_014418368.1 YqhG family protein -
  GWK37_RS01475 (GWK37_01480) sinI 311018..311191 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  GWK37_RS01480 (GWK37_01485) sinR 311225..311560 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GWK37_RS01485 (GWK37_01490) tasA 311608..312393 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GWK37_RS01490 (GWK37_01495) sipW 312458..313042 (-) 585 WP_015240205.1 signal peptidase I SipW -
  GWK37_RS01495 (GWK37_01500) tapA 313014..313685 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  GWK37_RS01500 (GWK37_01505) - 313944..314273 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GWK37_RS01505 (GWK37_01510) - 314314..314493 (-) 180 WP_003153093.1 YqzE family protein -
  GWK37_RS01510 (GWK37_01515) comGG 314550..314927 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  GWK37_RS01515 (GWK37_01520) comGF 314928..315323 (-) 396 WP_115940643.1 competence type IV pilus minor pilin ComGF -
  GWK37_RS01520 (GWK37_01525) comGE 315337..315651 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  GWK37_RS01525 (GWK37_01530) comGD 315635..316072 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=419198 GWK37_RS01475 WP_014418369.1 311018..311191(+) (sinI) [Bacillus velezensis strain CACC 316]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=419198 GWK37_RS01475 WP_014418369.1 311018..311191(+) (sinI) [Bacillus velezensis strain CACC 316]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment