Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GNE05_RS16165 Genome accession   NZ_CP047644
Coordinates   3262182..3262322 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. AM1(2019)     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3257182..3267322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GNE05_RS16140 (GNE05_16140) - 3257496..3257879 (-) 384 WP_160182981.1 hotdog fold thioesterase -
  GNE05_RS16145 (GNE05_16145) comA 3257901..3258545 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  GNE05_RS16150 (GNE05_16150) comP 3258626..3260977 (-) 2352 WP_328700097.1 histidine kinase Regulator
  GNE05_RS16155 (GNE05_16155) comX 3260955..3261125 (-) 171 WP_032863917.1 competence pheromone ComX -
  GNE05_RS16160 (GNE05_16160) - 3261125..3262051 (-) 927 WP_014721741.1 polyprenyl synthetase family protein -
  GNE05_RS16165 (GNE05_16165) degQ 3262182..3262322 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GNE05_RS16170 (GNE05_16170) - 3262787..3263128 (+) 342 WP_021495366.1 hypothetical protein -
  GNE05_RS16175 (GNE05_16175) - 3263135..3264358 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  GNE05_RS16180 (GNE05_16180) - 3264488..3265954 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  GNE05_RS16185 (GNE05_16185) - 3265972..3266523 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  GNE05_RS16190 (GNE05_16190) - 3266620..3267018 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=414898 GNE05_RS16165 WP_003152043.1 3262182..3262322(-) (degQ) [Bacillus sp. AM1(2019)]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=414898 GNE05_RS16165 WP_003152043.1 3262182..3262322(-) (degQ) [Bacillus sp. AM1(2019)]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment