Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   GNE05_RS12960 Genome accession   NZ_CP047644
Coordinates   2650996..2651310 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus sp. AM1(2019)     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2645996..2656310
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GNE05_RS12915 (GNE05_12915) sinI 2646677..2646850 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  GNE05_RS12920 (GNE05_12920) sinR 2646884..2647219 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GNE05_RS12925 (GNE05_12925) - 2647267..2648052 (-) 786 WP_007408329.1 TasA family protein -
  GNE05_RS12930 (GNE05_12930) - 2648117..2648701 (-) 585 WP_022552967.1 signal peptidase I -
  GNE05_RS12935 (GNE05_12935) tapA 2648673..2649344 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GNE05_RS12940 (GNE05_12940) - 2649603..2649932 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GNE05_RS12945 (GNE05_12945) - 2649973..2650152 (-) 180 WP_003153093.1 YqzE family protein -
  GNE05_RS12950 (GNE05_12950) comGG 2650209..2650586 (-) 378 WP_061862389.1 competence type IV pilus minor pilin ComGG Machinery gene
  GNE05_RS12955 (GNE05_12955) comGF 2650587..2650982 (-) 396 WP_061862390.1 competence type IV pilus minor pilin ComGF -
  GNE05_RS12960 (GNE05_12960) comGE 2650996..2651310 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  GNE05_RS12965 (GNE05_12965) comGD 2651294..2651731 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  GNE05_RS12970 (GNE05_12970) comGC 2651721..2652029 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  GNE05_RS12975 (GNE05_12975) comGB 2652034..2653071 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  GNE05_RS12980 (GNE05_12980) comGA 2653058..2654128 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  GNE05_RS12985 (GNE05_12985) - 2654321..2655271 (-) 951 WP_160182873.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=414879 GNE05_RS12960 WP_017418140.1 2650996..2651310(-) (comGE) [Bacillus sp. AM1(2019)]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=414879 GNE05_RS12960 WP_017418140.1 2650996..2651310(-) (comGE) [Bacillus sp. AM1(2019)]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment