Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GNE05_RS12915 | Genome accession | NZ_CP047644 |
| Coordinates | 2646677..2646850 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus sp. AM1(2019) | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2641677..2651850
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GNE05_RS12900 (GNE05_12900) | gcvT | 2642490..2643590 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GNE05_RS12905 (GNE05_12905) | - | 2644014..2645684 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| GNE05_RS12910 (GNE05_12910) | - | 2645706..2646500 (+) | 795 | WP_160182872.1 | YqhG family protein | - |
| GNE05_RS12915 (GNE05_12915) | sinI | 2646677..2646850 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| GNE05_RS12920 (GNE05_12920) | sinR | 2646884..2647219 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GNE05_RS12925 (GNE05_12925) | - | 2647267..2648052 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| GNE05_RS12930 (GNE05_12930) | - | 2648117..2648701 (-) | 585 | WP_022552967.1 | signal peptidase I | - |
| GNE05_RS12935 (GNE05_12935) | tapA | 2648673..2649344 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GNE05_RS12940 (GNE05_12940) | - | 2649603..2649932 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| GNE05_RS12945 (GNE05_12945) | - | 2649973..2650152 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GNE05_RS12950 (GNE05_12950) | comGG | 2650209..2650586 (-) | 378 | WP_061862389.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GNE05_RS12955 (GNE05_12955) | comGF | 2650587..2650982 (-) | 396 | WP_061862390.1 | competence type IV pilus minor pilin ComGF | - |
| GNE05_RS12960 (GNE05_12960) | comGE | 2650996..2651310 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GNE05_RS12965 (GNE05_12965) | comGD | 2651294..2651731 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=414876 GNE05_RS12915 WP_014418369.1 2646677..2646850(+) (sinI) [Bacillus sp. AM1(2019)]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=414876 GNE05_RS12915 WP_014418369.1 2646677..2646850(+) (sinI) [Bacillus sp. AM1(2019)]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |