Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GSY53_RS20245 Genome accession   NZ_CP047325
Coordinates   3958859..3959032 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain GOT9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3953859..3964032
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GSY53_RS20230 (GSY53_20230) gcvT 3954658..3955746 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  GSY53_RS20235 (GSY53_20235) hepAA 3956188..3957861 (+) 1674 WP_003230203.1 SNF2-related protein -
  GSY53_RS20240 (GSY53_20240) yqhG 3957882..3958676 (+) 795 WP_003230200.1 YqhG family protein -
  GSY53_RS20245 (GSY53_20245) sinI 3958859..3959032 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GSY53_RS20250 (GSY53_20250) sinR 3959066..3959401 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GSY53_RS20255 (GSY53_20255) tasA 3959494..3960279 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  GSY53_RS20260 (GSY53_20260) sipW 3960343..3960915 (-) 573 WP_003230181.1 signal peptidase I SipW -
  GSY53_RS20265 (GSY53_20265) tapA 3960899..3961660 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  GSY53_RS20270 (GSY53_20270) yqzG 3961932..3962258 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GSY53_RS20275 (GSY53_20275) spoIITA 3962300..3962479 (-) 180 WP_003230176.1 YqzE family protein -
  GSY53_RS20280 (GSY53_20280) comGG 3962550..3962924 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GSY53_RS20285 (GSY53_20285) comGF 3962925..3963308 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GSY53_RS20290 (GSY53_20290) comGE 3963334..3963681 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=412744 GSY53_RS20245 WP_003230187.1 3958859..3959032(+) (sinI) [Bacillus subtilis strain GOT9]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=412744 GSY53_RS20245 WP_003230187.1 3958859..3959032(+) (sinI) [Bacillus subtilis strain GOT9]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment